KEGG   Neisseria lactamica: NLA_5900Help
Entry
NLA_5900          CDS       T01368                                 

Gene name
dhpS
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nla  Neisseria lactamica
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NLA_5900 (dhpS)
Enzymes [BR:nla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NLA_5900 (dhpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
585479..586336
Genome map
AA seq 285 aa AA seqDB search
MVGCVWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAQTALAHAERLLKEGADILD
IGGESTRAGADYVSPEEEWARVEPVLAEVAGWGVPVSLDTRRTVVMEKALALGGIDIIND
VAALTDEGALELLACQADTGICLMHMQGLPENMQINPKYQDVVGEVARYLKARAAECVAA
GIAPQRITLDPGFGSGFGKTLQHNIALMRHLPELMAETGLPLLVGVSRKSTIGELTGEAD
AAARVHGSVAAALASVARGAQIVRVHDVKATADALKAWEALGINL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggtcggatgcgtttggcaggcaggacggtttgaaatcggtttggacaaaccgaaaatc
atgggtatcgtgaatctcacgcccgattctttttccgacggcggcgcgtattcgcaaaac
gcccaaaccgctttggcgcatgccgaacggcttttgaaagagggtgcggacattctcgac
atcggcggtgaatcgacgcgggcaggtgcggattatgtttcgcctgaagaagaatgggcg
cgggttgaacctgtattggcagaagtggcggggtggggcgttcccgtcagtttggacacg
cgccgcacggtggttatggaaaaagcgttggcactcggcggcatcgatattattaacgat
gtggcggcgttgaccgacgaaggcgcgctcgaattgctggcgtgtcaggcggatacgggc
atttgcctgatgcacatgcagggtttgccggaaaacatgcagattaatccgaaatatcag
gatgttgtcggcgaagtggcaaggtatttgaaggcgcgggcggcggaatgtgtcgcggca
ggcatcgcaccgcaacgcatcacactcgaccccggtttcggctccggcttcggcaaaacc
ttgcaacacaatatcgcgctgatgcggcatttgcccgaattgatggcggaaaccggtttg
ccgctgctggtcggcgtgtcgcgcaagagcacgataggcgagctgaccggcgaggcagac
gcggcggcgcgcgtacacggcagcgtggcggcggcgctggcttccgtggcgcgcggcgcg
caaatcgtgcgggtgcacgatgtgaaggcgacggcggacgcgttgaaggcgtgggaagcg
ttgggcatcaatctgtaa

DBGET integrated database retrieval system