KEGG   Neisseria lactamica: NLA_6390Help
Entry
NLA_6390          CDS       T01368                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
nla  Neisseria lactamica
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NLA_6390 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    NLA_6390 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NLA_6390 (lacZ)
Enzymes [BR:nla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     NLA_6390 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
644017..647055
Genome map
AA seq 1012 aa AA seqDB search
MLLANYYQDPEITRINALPHHSYFIPFDKKDKVDQFSRENSSFFTSLNGMWQFAYYPSMQ
DLPESPDEIAFTKQINVPSNWQNHGFDAHQYTNINYPFPFDPPFVPLENPCGVYQKQVNL
KKNINKRYLLVLEGVDSCSYIYVNHQFVGYGSISHSTNEFDITDYLHDGENTLTVFVLKW
CAGSYLEDQDKFRMSGIFRDVYLLEREHHYLQDLNIRTVLSEDLSLGRICLDLNFAGDAG
DVGVSLLDTDGQIVQAGSAITTDKQRMQIRLDNIPLTKSRLWNAENPALYTLVLNTKEEI
ITQKIGFRKVEVKNGVLLLNNQPIKFKGVNRHDSDPKTGYAISVAQAVTDLSLMKKHNIN
AIRTAHYPNSPWFCELCDKYGFYVISESDIESHGAAFQAISHPEPSIFLNVENPNEEPRI
RQQTIDNFCYFAREPLYRAALLERTKANIERDKNRSSILIWSLGNESGYGENFEYCAKWV
KERDPDRLVHYESSIYQHSAYQNNTGHLDLYSEMYSDTEAIDAYFADHSQTKKPFLLCEY
SHAMGNSNGDMEDYFQTFNKYSGCCGGFIWEWCDHAQYITPTKLGYGGDFGEKIHDGNFC
VDGLVSPERVPHSNLLEVKNVNRPVRANLRGEQIELYNYFDFTNLKDILCVKYEWVKNGQ
ITGTGTLAVDCEPHHSQILPIQLPKEREGLLWLNLYYCASRQTDLLPAGHHFGFDQIILS
KEYTPAIGSDKDDCPPLEITETVRQIVVRNNRYYFEFNKLTGIIDEIKVNGKAFIHKPLA
WNIWRAPTDNDRLIRSQWQNAGYDQMYSKVYDICAHRQGNGVVVSVKSALVADAKSKIMT
LETQYLLSENGKLDIQTNAVFHEHLPFLPRFGLRFFLDEQKTPFTYLGYGAGESYIDKHQ
ATKLGIYSTTAGENHVGYLKPQENGSHYGCFYVQNDMIRVESGQPFSFNLSPYTQEELTQ
KKHSYELVCSGYDVLCIDYKMSGIGSNSCGPNLKPQYRLIENNINFDISIRL
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgttattagcgaattattatcaagatcctgaaatcacgagaatcaatgcgttgccgcac
catagctattttatcccttttgataaaaaagataaggtagatcagttttctagggaaaac
tcttcgttttttacatcattaaatggaatgtggcaattcgcatattatccgagtatgcag
gatttacctgaaagtccggacgaaatcgcttttacgaaacaaatcaatgtgccttcaaat
tggcagaatcacgggtttgatgcccatcaatatactaatattaattatcctttccctttc
gatccgccttttgttcctttagagaacccttgcggggtatatcaaaaacaggtcaatctg
aaaaagaatataaataagcggtatttattagtccttgaaggggttgattcctgttcttat
atatatgtaaaccatcaatttgtaggatatggttctatcagccacagtaccaatgaattt
gatattaccgattatcttcacgatggtgaaaacacccttaccgtatttgttctgaaatgg
tgtgccggaagctacttggaagatcaggataaatttagaatgtcgggaattttccgagat
gtatatttattggaaagggaacatcactatttgcaagacttgaatattcgaaccgtgctt
tctgaagatttatcattggggcggatttgtctggatttaaattttgcgggggatgcgggg
gatgtcggagtgtcattgcttgatacggacgggcaaattgttcaagcaggcagcgcaatc
acgacagataaacaacggatgcaaatccgccttgataatattcctttaaccaaatcccga
ctctggaatgcggaaaaccctgccctttataccttggtattaaacacaaaagaagaaatc
attacccaaaagatcggattccgcaaggtagaggtcaaaaacggggtattactgcttaat
aaccagcctattaaattcaaaggggtaaaccggcacgatagcgatcccaagacgggatac
gccatttctgtcgctcaagcggtgactgacttgtcgttaatgaagaaacataatattaac
gcgattcgtaccgcgcattatccaaattcaccgtggttttgcgagctttgcgataagtat
ggtttctatgtaatcagtgaaagcgacattgaaagtcatggggcggcattccaagcaatt
tcgcatcccgaaccgagtatctttctgaatgtggaaaatccgaatgaagagccgcgtatc
cgccaacaaactattgacaacttctgttattttgcccgagaaccattgtatcgggcggct
ttattggagcggactaaagcaaatatagaacgtgataagaaccgcagttctattttaatt
tggtctttaggcaatgaatcagggtatggtgagaatttcgaatattgtgcaaaatgggta
aaagagcgggatccggatcgattggttcattacgaaagcagcatttatcagcattctgcg
tatcagaataacaccgggcatttggatttatacagtgaaatgtattccgacacagaagca
atcgatgcctattttgccgatcattcacaaacgaaaaaaccattcttattatgcgaatat
tcccatgcaatgggaaattcaaatggagatatggaagactatttccaaacatttaacaaa
tattcgggctgttgcggtgggtttatttgggagtggtgcgatcatgcccaatatattacc
ccgacaaaattaggatatggcggtgacttcggcgaaaaaatccatgatgggaatttctgt
gtggatggcttggtttcgcccgaacgcgtcccgcacagcaacctgttggaagtaaaaaat
gtcaaccggcccgtacgggcaaacttgcgcggtgaacaaattgagttatataactatttt
gatttcactaatttaaaagatattctttgcgtcaaatatgaatgggtaaaaaatggtcag
ataaccgggacgggaacattggcggttgattgcgaaccccatcattctcaaatcttaccg
attcagcttcccaaagaacgggaaggattgctatggttgaacctatattactgcgcttcc
cggcaaactgatttattgccggcaggacatcatttcggtttcgatcaaattattttgagt
aaggaatacactcctgccataggatcggataaagatgattgcccgccgttggaaataacc
gaaacagtgagacaaatcgttgttcggaacaatcgatattattttgaatttaacaagctc
acggggataattgacgaaattaaagtcaatggcaaggctttcatccataaaccgttggct
tggaatatttggcgcgcgccgacggataatgaccgcctgattcgttcccaatggcaaaat
gccggttatgatcaaatgtattccaaggtttacgatatttgcgcgcatcggcaaggaaac
ggtgttgtcgtgtctgtgaaaagtgcattggttgcggatgcaaaatcaaaaatcatgaca
ttggaaacacagtatctgctgtctgaaaatggtaaattggatattcaaacaaatgctgtt
ttccacgagcatttgccattcctgccccgtttcggtttgcgctttttcttagacgaacag
aaaacaccttttacctacttaggttatggggcgggtgaaagctatattgataaacatcag
gcgaccaaacttggtatttattcgacaacggcaggggaaaatcatgttggctatctcaag
cctcaagagaacggcagccattatggatgcttttatgttcaaaacgatatgatccgggtg
gagtcggggcagccgtttagtttcaacctgtccccttatacgcaagaagaactgacgcag
aaaaaacattcttatgaattggtttgttccgggtatgatgtattgtgtatcgactataag
atgagcggtatcggttcgaattcttgcgggcctaatttgaagccgcaatatcgtttgatt
gaaaataacatcaatttcgatataagtatccggttatag

DBGET integrated database retrieval system