KEGG   Neisseria lactamica: NLA_9280Help
Entry
NLA_9280          CDS       T01368                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nla  Neisseria lactamica
Pathway
nla00010  Glycolysis / Gluconeogenesis
nla00052  Galactose metabolism
nla00500  Starch and sucrose metabolism
nla00520  Amino sugar and nucleotide sugar metabolism
nla00521  Streptomycin biosynthesis
nla01100  Metabolic pathways
nla01110  Biosynthesis of secondary metabolites
nla01120  Microbial metabolism in diverse environments
nla01130  Biosynthesis of antibiotics
nla01200  Carbon metabolism
Module
nla_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NLA_9280 (glk)
   00052 Galactose metabolism
    NLA_9280 (glk)
   00500 Starch and sucrose metabolism
    NLA_9280 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NLA_9280 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NLA_9280 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NLA_9280 (glk)
Enzymes [BR:nla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NLA_9280 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CBN87156
UniProt: E4ZCS3
Position
976398..977384
Genome map
AA seq 328 aa AA seqDB search
MSSTPNKHADYPRLVADIGGTNARFALETAPCVIEKVAVLPCKEYDTVTDAVRTYLKQNG
TEGVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQALGLDTLILLNDFTAQALAVTQTS
SKDLMQIGGQKPVEFAPKAVIGPGTGLGVSGLVHSAAGWVALAGEGGHTSFPPFDDMEVL
IWQYAKNKYRHVSAERFLSGAGLSLIYEALAAKQKAGPAKLMPSEITEKALNCESPLCRQ
ALDIFCAMLGTVASNLALTLGARGGVYLCGGIIPRMLDYFKTSPFRSRFENKGRFEAYLA
AIPVYVVLSEFPGISGAAAALGNHLKNV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacgccgaataaacacgccgattacccgaggctggttgccgacatcggcggc
acaaacgcccgtttcgcattggaaaccgcgccgtgcgtgattgagaaagtcgccgtcctg
ccgtgtaaggaatacgacacggttaccgacgcggtgcgcacctacctgaaacaaaacggg
acggaaggcgtgcggcacgccgcctttgccattgccaacccgattttgggcgactgggtg
cagatgaccaaccaccattgggcgttttccatcgaaaccacccgtcaggctttggggttg
gacacgctgattctgttgaacgactttaccgcgcaggcattggcggtaacgcagacttca
agcaaagacctgatgcagataggcgggcagaagcctgtcgaatttgcccccaaagccgtt
atcggccccggtaccggcttgggcgtgagcggattggtgcacagcgccgcaggctgggtg
gcgttggcaggcgagggcgggcacaccagttttccgccgtttgacgatatggaagtgctg
atttggcagtacgccaaaaacaaataccgccacgtttccgccgaacgcttcctcagcggc
gcgggtttgagcctgatttacgaagcactggcagccaagcagaaagccgggccggcaaaa
ctgatgccgtctgaaatcaccgaaaaggcattaaattgcgaatcgcccctgtgccggcag
gcattggatattttctgcgcgatgctgggcacggtcgcttccaacctcgccctgactttg
ggtgcgcgcgggggcgtgtatttgtgcggcggcattatcccgcgtatgttggattacttc
aaaacctcccccttccgcagccgttttgaaaacaaagggcgttttgaagcctaccttgcc
gcgattcccgtttatgtcgttttgagcgaatttccgggcatttccggcgcggcggcggcg
ctcggcaaccacctgaaaaacgtttaa

DBGET integrated database retrieval system