KEGG   Neisseria lactamica: NLA_9540Help
Entry
NLA_9540          CDS       T01368                                 

Gene name
proB
Definition
(GenBank) putative glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
nla  Neisseria lactamica
Pathway
nla00330  Arginine and proline metabolism
nla00332  Carbapenem biosynthesis
nla01100  Metabolic pathways
nla01130  Biosynthesis of antibiotics
nla01230  Biosynthesis of amino acids
Module
nla_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NLA_9540 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NLA_9540 (proB)
Enzymes [BR:nla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NLA_9540 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CBN87181
UniProt: E4ZCU8
Position
complement(1003798..1004907)
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSLTCPDGTLSRGKIQALTRQLAALHRAGHETVLVSSGAVAAGFGALG
FKKRPVKIADKQASAAVGQGLLMEEYTACLSSDGIVSAQILLNRADFSDKRRYQNAAAAL
SVLLQRRAVPIINENDTVSVEELKIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNS
NPDAVRLDRIEHINHEIIAMAGGAGSANGTGGMLTKIKAATIATESGVPVYICSSLKDNA
LAEAAGHQADGSFFVPRAKGLRTQKQWLAFYSESRGGVYVDEGAEHALSEQGKSLLMSGV
VGIEGHFSRMDTVTVYSNATKQPLGKGRVLFGSAAAEDLLKSRKAKGVFIHRDDWISITP
EIRLLLTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaaagaatcgtatttaaagtcggaacttcttcgctaacctgtccggacggc
acgctctcgcgcggcaaaatccaagccctgacccgccagctcgccgcgctgcaccgcgcc
ggacacgagacggttttggtttcctccggcgcggttgcggcagggttcggtgcgctgggt
ttcaaaaaacgcccggttaaaattgccgacaaacaggcttccgccgccgtcgggcagggg
ctgctgatggaagaatacaccgcctgcctgtcttcagacggcatcgtatccgcgcaaatc
ctgctcaaccgcgccgacttttccgacaaacgccgctaccaaaatgccgccgccgcgctt
tccgtactactgcaacgccgcgccgtccccattatcaatgaaaacgacacggtttctgtc
gaagagttgaaaatcggcgacaacgacacgctcagcgcgcaggttgcggcgatgatacag
gcagacctcttggtgctgctgaccgacatagacgggctttataccggcaacccgaacagc
aatcccgatgccgtacggctggacagaatcgaacacatcaaccatgaaattatcgcaatg
gcgggcggcgcgggttcggcaaacggcacgggcgggatgctgaccaaaatcaaagcggcg
acgattgcgaccgaatccggcgtcccggtgtatatctgttcctcgcttaaagacaacgcc
cttgccgaagccgccggacatcaggcggacggctcgtttttcgtcccccgtgccaaaggc
ttgaggacgcagaaacaatggctggcgttttactcggaaagccggggcggcgtttatgtg
gacgaaggtgcggaacacgccttgtcggaacagggaaaaagcctgctgatgtcgggcgtt
gtcggaatcgaagggcatttttcccgtatggacaccgtaaccgtgtacagcaacgcaacc
aaacagcctttgggcaaagggcgcgtccttttcggctctgctgccgccgaagacctgctc
aaatcgcgcaaagcgaaaggcgtgttcatccatcgggacgattggatttccattacgccc
gaaatacgcctgcttctgaccgaattttag

DBGET integrated database retrieval system