KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100586693Help
Entry
100586693         CDS       T03265                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
Glycerolipid metabolism
Metabolic pathways
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:nle00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100586693
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100586693
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100586693
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100586693
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S33
   100586693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
21
AA seq 207 aa AA seqDB search
MGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKDYSRILKHLMEKASRMLKFWIP
RPFWVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNA
VSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELP
EVTNSVFHEINMWVSQRTATAGTASPP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcgccatcgccattctcacggctgcagagaggccgggccactttgccggcatg
gtactcatttcgcctctggttcttgccaatcctgaatctgcaacaactttcaaggattat
tcgaggattttgaaacacttgatggaaaaggcatcaagaatgttaaagttttggattcca
cgtcctttttgggtccttgctgcgaaagtgctcaaccttgtgctgccaaacttgtccctt
gggcccatcgactccagcgtgctctctcggaataagacagaggtcgacatttataactca
gaccccctgatctgccgggcagggctaaaggtgtgcttcggcatccagctgctgaatgct
gtctcgcgggtggagcgcgccctccccaagctgactgtgcccttcctgctgctccagggc
tctgccgatcgcctgtgtgacagcaaaggggcctacctgctcatggagttagccaagagc
caggacaagactctcaagatttatgaaggtgcctaccatgttctccacaaggagcttcct
gaagtcaccaactccgtcttccatgaaataaacatgtgggtctctcaaaggacagccact
gcaggaactgcgtccccaccctga

DBGET integrated database retrieval system