KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0244Help
Entry
NMA0244           CDS       T00031                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMA0244
Enzymes [BR:nma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     NMA0244
    3.5.1.-  
     NMA0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(228080..228715)
Genome map
AA seq 211 aa AA seqDB search
MIVSIDVDAQKTFTPLCPKELPVNEGHLIVEELNAQAALADLRVMTKDAHYMVAKWLVDN
PVDMLKPTGLPDADLTWVAHAMVGTRGYELLDGLPSAKEYDYCVWKGVDPELHPYGACFH
DIEEKLSTGLIEWLRCQNTDMVIVGGLATDYCVKTTVLQLLKGSNWQVIVNEAACRGIAP
DTIETAWQEMRSAGAVILKNAEEIKKYINNQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttccattgatgttgatgcacaaaaaacttttacgcctttgtgtcctaaagag
ctgcctgtaaacgaggggcatttgattgtcgaagaattgaatgcccaagccgctttggcg
gatttgcgcgtgatgacgaaagatgcgcattatatggtagcgaaatggcttgtggataac
cctgttgatatgttgaagccgacaggtttgcctgatgcggatttgacttgggtggctcat
gcgatggtcggtacgcgcggctatgaattattggacggactgccttctgccaaagaatac
gattattgcgtttggaaaggtgttgatcctgaattgcatccttacggcgcgtgttttcac
gatattgaggaaaaactgagcactggattgattgagtggctgcgttgtcaaaatacggat
atggtcattgtcggcggtttggctacggattattgtgttaaaacaacggttttgcagttg
ctcaaaggtagcaattggcaggttatcgtcaatgaagcggcttgtcggggtattgcgccg
gataccattgaaacggcatggcaggaaatgcgttctgccggtgctgtcatcttaaaaaac
gccgaagaaattaaaaaatatattaataatcaataa

DBGET integrated database retrieval system