KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0351Help
Entry
NMA0351           CDS       T00031                                 

Definition
aspartate-semialdehyde dehydrogenase (EC:1.2.1.11)
Orthology
K00133  
aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NMA0351
   01230 Biosynthesis of amino acids
    NMA0351
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMA0351
   00270 Cysteine and methionine metabolism
    NMA0351
   00300 Lysine biosynthesis
    NMA0351
Enzymes [BR:nma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     NMA0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(326780..327895)
Genome map
AA seq 371 aa AA seqDB search
MKVGFVGWRGMVGSVLMQRMKEENDFAHIPEAFFFTTSNVGGAAPDFGQAAKTLLDANDV
AELAKMDIIVTCQGGDYTKSVFQPLRDSGWNGYWVDAASSLRMKDDAIIVLDPVNRNVID
NGLKNGVKNYIGGNCTVSLMLMALGGLFQNDLVEWATSMTYQAASGAGAKNMRELISGMG
AIHAKVADELADPSSAILDIDRKVSDFLRSEDYPKANFGVPLAGSLIPWIDVDLGNGQSK
EEWKGGVETNKILGRSDNPTVIDGLCVRIGSMRCHSQALTLKLKKDLPVSEIEAILAGAN
DWVKVIPNEKEASIHELTPAKVTGTLSVPVGRIRKLEMGGEYISAFTVGDQLLWGAAEPL
RRVLRIVLGSL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaggtttcgtcggctggcgcggtatggtcggttcggttttgatgcagcgtatg
aaagaagaaaacgacttcgcccacattcctgaagcgtttttctttaccacttccaacgtc
ggcggcgcagcccctgatttcggtcaggcagccaaaacattgttggatgccaacgatgtt
gccgaattggcaaaaatggacatcatcgttacctgtcagggcggcgattacaccaaatcc
gtcttccaacccctgcgcgacagcggctggaacggctactgggttgacgcggcgtcatcc
ctgcgcatgaaagacgatgcgattatcgtcctcgacccggtcaaccgcaacgtcatcgac
aacggcctcaaaaacggcgtgaaaaactacatcggcggcaactgtaccgtttccctgatg
ctgatggctttgggcggtctgttccaaaacgatttggtcgaatgggcaaccagcatgacc
taccaagccgcttccggtgcgggtgcgaaaaacatgcgcgaactcatcagcggcatgggc
gcgattcacgccaaagtagcggacgagcttgccgatccttccagcgcgattctcgacatc
gaccgcaaagtgtccgatttcctgcgcagcgaagactatccgaaagccaacttcggcgta
ccgctcgccggcagcctgattccgtggattgacgtggatttgggcaacggtcaatctaaa
gaagaatggaaaggcggtgtggaaaccaacaaaatcctcggccgcagcgacaatccgacc
gtaatcgacggcttatgcgtacgcatcggctctatgcgctgccacagccaagccctcacc
ctgaagctgaaaaaagacctgcctgtttccgaaatcgaagcgattttggcaggtgcaaac
gactgggtgaaagtcatccctaacgaaaaagaagccagcatacacgagctgactcctgcc
aaagttaccggcacactgtctgttcctgtcggccgtatccgcaaactggagatgggcggc
gaatacatcagcgcgttcactgtcggcgaccaactcttgtggggggctgccgagccgttg
cgccgcgtgctgcgtatcgtgttgggcagcctgtaa

DBGET integrated database retrieval system