KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0570Help
Entry
NMA0570           CDS       T00031                                 

Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMA0570
   01230 Biosynthesis of amino acids
    NMA0570
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMA0570
   00051 Fructose and mannose metabolism
    NMA0570
   00562 Inositol phosphate metabolism
    NMA0570
Enzymes [BR:nma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NMA0570
Exosome [BR:nma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NMA0570
  Exosomal proteins of bladder cancer cells
   NMA0570
  Exosomal proteins of melanoma cells
   NMA0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(542093..542848)
Genome map
AA seq 251 aa AA seqDB search
MWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIGLAAPTVYLLQLHNAMQIVLNN
RILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQRRKMENV
LNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGTGKVATV
EQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGASLSYDS
FTAIISAAQNA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtgggatcaaaaatgggtcatcggcaactggaaaatgaacggccggctccagaacaac
aattcgctcatgcaccgcttccgcatcctccccaccgccgaacgcgtcctcatcggactc
gccgccccgaccgtttacctgctgcaactgcacaacgccatgcaaatcgtcttaaacaac
cgcatcctcacctgcgcccaagacgtgagccgcttccccgacaacggcgcgtacaccggc
gaagtgtccgccgaaatgctcgccgacaccggcacagacatcgtcctcatcggacactcc
gaacgcagcctttatttcggcgaaaaaaacgaaatccaacgccgcaaaatggaaaacgtc
ctcaacgtcggactcatcccgttattgtgcgtcggcgaaagcctcgaagagcgcgaagcc
ggcaaagaacacgaagtcatcgcccatcagctttccatcctgcaaggactggacaccaaa
aacatcgccgtcgcctacgaacccgtctgggcgatcggcaccggcaaagtcgccaccgtc
gaacagattgccgatatgcacgcattcatctacaaagaaatcttgtctttgtgcggaagc
gatgttaaaatccgcgtcctttacggcggaagtgtgaaagcggacaacgcggccgacatc
ttcgcagtaccttatgtggacggcgcactcgtcggcggcgcgtcattgtcgtacgactcc
tttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system