KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0572Help
Entry
NMA0572           CDS       T00031                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
543655..544311
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRELFVDEDLQGLAYADMALPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGKVVSDDLDAEQQNRAKAVLD
GLGLDNIDYVQNNGLTELSAGAPFDAVYVGGAVNLVPEVLKEQLKDGGRMAVIVGRKPVQ
RALLITRKGDVFEEKVLFDTLVAHLDDKDTDPFGGFDF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcaaatccgtccttgggatgta
ttggattttgatgtgttggacgctttggcggagattccgcgcgagctttttgtcgatgag
gacttgcagggtttggcgtatgcggatatggcactgccgcttgccaacgggcataagatg
ctggagccgaaagtcgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggctcgggctatgcgaccgcgcttttggcaaaattggcgggc
aaagtagtctcggacgacctcgatgccgaacagcaaaaccgcgccaaagcggtgttggac
ggcttgggtttggacaatatcgattatgtgcaaaacaacgggttgaccgaactttccgca
ggtgcgccgtttgatgcggtttatgtcggcggtgcggtaaaccttgtgcctgaagtgttg
aaagaacagttgaaagatggcggacgcatggcggttatcgtaggccgcaagcctgttcag
cgcgcgcttttgattacgcgcaagggcgatgtgtttgaagagaaggtgctgttcgatact
ttggtggcgcatttggacgataaggataccgatccgtttggcggtttcgatttttaa

DBGET integrated database retrieval system