KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0725Help
Entry
NMA0725           CDS       T00031                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00010  Glycolysis / Gluconeogenesis
nma00071  Fatty acid degradation
nma00350  Tyrosine metabolism
nma00625  Chloroalkane and chloroalkene degradation
nma00626  Naphthalene degradation
nma01100  Metabolic pathways
nma01110  Biosynthesis of secondary metabolites
nma01120  Microbial metabolism in diverse environments
nma01130  Biosynthesis of antibiotics
nma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMA0725
  Lipid metabolism
   00071 Fatty acid degradation
    NMA0725
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMA0725
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMA0725
   00626 Naphthalene degradation
    NMA0725
Enzymes [BR:nma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMA0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 CoA_binding Methyltransf_25 TrkA_N DUF2237 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: CAM07979
UniProt: A0A0U1RHU1
Position
complement(717081..718121)
Genome map
AA seq 346 aa AA seqDB search
MQAVVVNKNVAGDVEVVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVLGH
EGIGLVKEVADGVKHLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGGMA
THCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSSVRPGQWIAIYGAGGLGNLGV
QYAKKVFGAHVVAIDINDDKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTAVS
AAAFNSAVNCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQFGA
EGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaagtcgtagaacgcgag
gttcgcccgttggaatacggcgaggcattggtcgaagtcgaatattgcggcgtgtgccac
accgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgctgggacac
gagggcatcggtttggttaaagaagttgccgacggtgtgaaacatctgaaagtcggcgac
cgcgtcagcatcgcctggctgttccaaagctgcggctcttgcgaatactgcaataccggc
cgcgaaaccctgtgccgctctgtattgaacgcgggctacaccgccgacggcggtatggcg
acccactgcatcgtgagtgccgattacgcggtcaaagtcccagaaggtttggatcctgcg
caagcttccagcattacttgtgccggcgtgaccacctataaagccattaaagtttccagt
gttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttgggggtc
caatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgacgacaaa
ctggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaggacgct
gccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgccgtatct
gctgccgcattcaactctgccgtgaattgcgtccgcgcgggcggacgtgtggttgccatc
ggactgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggcatcgaa
gtggtcggctctttggtcggcacgcgcaaagatttggaagaagctttccaattcggcgcg
gaaggtttggttgtgccgaaagtccaactgcgtgctttggatgaagcacccgccattttc
caagaaatgcgcgaaggcaaaatcaccggccgtatggtgatcgatatgaaaaaagaatgc
ggctgcggccatcaccgctga

DBGET integrated database retrieval system