KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0730Help
Entry
NMA0730           CDS       T00031                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(722619..723401)
Genome map
AA seq 260 aa AA seqDB search
MKTKLIKILTPFTVLPLLACGQTPVSNANAEPAVKAESAGKSVAASLKARLEKTYSAQDL
KVLSVSETPVKGIYEVVVSGRQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDF
ASLPLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEKMTDVTVYSFMMPIAGLHPDA
ARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNG
RSQSGYSPMPQLEEIIRKNQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttaatcaaaatcttgaccccctttaccgtcctcccgctgctggcttgc
gggcaaacgcccgtttccaatgccaacgccgaacccgccgtcaaagccgagtccgccggc
aaatccgttgccgcctctttgaaagcgcgtttggaaaaaacctattccgcccaagatttg
aaagtgttgagcgtcagcgaaacaccggtcaaaggcatttacgaagtcgtcgtcagcggc
aggcagattatctacaccgatgccgaaggcggctatatgttcgtcggcgaactcatcaac
atcgacacgcgcaaaaacctgaccgaagaacgcgccgccgatttgaacaaaatcgacttc
gcctccctgcctttggacaaagccatcaaagaagtgcgcggcaacggcaagctgaaagtc
gccgtcttctccgaccccgattgtccgttctgcaaacgcttggaacacgagtttgaaaaa
atgaccgacgtgacggtttacagctttatgatgcccattgccggcctgcaccccgatgcc
gcgcgcaaggcgcaaatcttatggtgtcagcccgaccgcgccaaagcgtggacggattgg
atgcgtaaaggcaaattcccggtcggcggcagcatctgcgacaatcccgtcgcggaaacc
acttccttgggcgaacaattcggcttcaacggcacgccgaccctcgtcttccccaacggg
cgcagccaaagcggctacagcccgatgccccaactggaggaaatcatccgcaaaaatcaa
taa

DBGET integrated database retrieval system