KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0879Help
Entry
NMA0879           CDS       T00031                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMA0879 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMA0879 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMA0879 (trpA)
Enzymes [BR:nma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMA0879 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
853953..854738
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALDGGKALIPYITVGDPDIRTTLALMHGMVANGADILELGVPFSDPMADGP
VIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPVHKMGYREFAQEAAKAG
VDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGV
TGAASLDTDEVSRKIEYLHQYIDIPIGVGFGISNAESARKIGRVAEAVIVGSRIVKEIEN
NAGNEAAVVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttggatggcggaaaggcattgattccctat
attacggtgggcgaccccgatattcggacaactttggcattgatgcacggcatggttgca
aacggtgcggatattttggagttgggtgtgccgttttccgatccgatggcggatgggccg
gttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctgcgcgatgtcttg
gatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgttttgatgggatat
ttgaaccctgtacataagatgggttatcgggagtttgctcaggaagccgcaaaggcgggt
gtggacggcgtgttgacggtggattcccctgtcgaaaccatcgatccgctctatcgcgag
ctgaaggataacggggtcgactgtattttcctgattgcgccgacgacgacggaagaccgt
attaaaaccattgccgagctggcaggcggatttgtctattatgtttcgctcaagggcgta
acgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagagtatttgcatcag
tatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaaagcgcgcgcaaa
atcggccgggttgccgaagcggtcattgtcggcagccggattgtgaaagagattgaaaac
aatgcgggcaacgaggctgcggtcgtcggtgctttggtcaaagagttgaaggatgccgtg
cgctga

DBGET integrated database retrieval system