KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0958Help
Entry
NMA0958           CDS       T00031                                 

Definition
(GenBank) putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine-pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00790  Folate biosynthesis
nma01100  Metabolic pathways
Module
nma_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMA0958
Enzymes [BR:nma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NMA0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: CAM08182
UniProt: A0A0U1RI73
Position
complement(925280..925774)
Genome map
AA seq 164 aa AA seqDB search
MNNRHFAVIALGSNLENPAQQVRAALDTLSSHPDIRLKQASSLYMTAPVGYDNQPDFVNA
VCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDIIDFDGISSDDPRLTLPHPR
AHERSFVIRPLAEILPDFILGKHGKVAELSKRLGNQGIRLLPDK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagacattttgccgtcatcgccctgggcagtaatcttgaaaaccctgcccaa
caggtacgcgccgcattggacacgctgtcgtcccatcctgacatccgtcttaaacaggct
tcctcactgtatatgaccgcgcccgtcggttacgacaatcagcccgatttcgtcaatgcc
gtctgcaccgtttccaccaccttggacggcattgccctgcttgccgaactcaaccgtatc
gaagccgatttcggacgcgaacgcagcttccgcaacgcgccgcgcacattggatttggac
attatcgactttgacggcatctccagcgacgacccccgactcaccctgccgcatccgcgc
gcgcacgaacgcagtttcgtcatacgccctttggcagaaatcctccctgattttattttg
ggaaaacacggaaaggttgccgaattgtcaaaacggctgggcaatcaaggcatccgtctt
ttaccggataagtaa

DBGET integrated database retrieval system