KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1150Help
Entry
NMA1150           CDS       T00031                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMA1150 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMA1150 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NMA1150 (sucB)
Enzymes [BR:nma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMA1150 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1100403..1101614
Genome map
AA seq 403 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPAAATAAAEAPAAAPAEAAPAAAPAAAQNNAAMP
AAAKLAAESGVDVNALQGSGRDGRVLKEDVQNAAAKPAAAAAPAVALPAGARPEERVPMS
RLRARVAERLLASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAA
VAALKKYPVVNASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDY
AKKAKDGKIAIEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQV
VVRPMMYLALSYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgtatcgataccgctgct
actgccgctgctgaagcacctgccgctgctactgccgctgctgaagcacctgccgccgct
cctgccgaagctgccccggccgccgctcctgctgctgcacaaaacaacgccgctatgcct
gccgccgccaaactggctgcagagagcggtgttgacgtgaacgcattgcaaggttccggc
cgtgacggtcgcgtattgaaagaagacgtacaaaatgccgcagccaaacctgccgcagcc
gctgctcctgccgttgcacttcctgccggcgcacgtcctgaagaacgcgtaccgatgagc
cgcctgcgtgcccgtgttgcagaacgcctcttggcttctcaacaagaaaacgccattctg
actacattcaacgaagtcaacatgaaaccaatcatggacttgcgtgcgaagtacaaagaa
aaattcgagaaagaacacggcgtgaaactgggctttatgtccttcttcgttaaagccgct
gttgcagccctgaaaaaatacccggttgtgaatgcttctgttgacggcaaagacattgtg
taccacggctacttcgacatcggtatcgcgattggcagcccacgcggtttggttgtgcca
atcctgcgcgatgccgaccaaatgagcattgccgacatcgaacaagcaattgttgattac
gcgaaaaaagccaaagacggcaaaatcgctatcgaagatctgaccggcggtacattcagt
attaccaacggcggtactttcggttctatgatgtccaccccgatcatcaatccgcctcaa
tctgcgattttgggtatgcacgccactaaagagcgcgctgtggttgaaaacggccaagtt
gttgtccgtccaatgatgtatctggctctgtcttacgaccaccgtatcattgacggccgc
gaagctgtattgaccttggtagccattaaagacgcgttggaagacccagcccgcctgttg
ttggatctgtaa

DBGET integrated database retrieval system