KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1268Help
Entry
NMA1268           CDS       T00031                                 

Definition
(GenBank) putative glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00330  Arginine and proline metabolism
nma00332  Carbapenem biosynthesis
nma01100  Metabolic pathways
nma01130  Biosynthesis of antibiotics
nma01230  Biosynthesis of amino acids
Module
nma_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMA1268
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NMA1268
Enzymes [BR:nma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NMA1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAM08456
UniProt: Q9JUK7
Position
complement(1196536..1197645)
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSITHSDGSLSRGKIQTITRQLAALHHAGHELVLVSSGAVAAGFGALG
FKKRPVKIADKQASAAVGQGLLMEEYTANLSSDGIVSAQILLSRADFADKRRYQNAGGAL
SVLLQRRAVPIINENDTVSVEELKIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNS
NPDAVRLDKIEHINHEIIEMAGGSGSANGTGGMLTKIKAATIATESGVPVYICSSLKPDA
LAEAADNQADGSFFVPRAKGLRTQKQWLAFYSESRGGVYVDEGAEHALSEQGKSLLMSGI
AGIEGHFSRMDTVTVYSKATKQPLGKGRVLFGSAAAEDLLKLRKAKGVFIHRDDWISITP
EIRLLLTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaagaatcgtatttaaagtcggcacatcttcgattacccattcggacggc
agtctctcgcgcggcaaaatccaaaccatcacccgccagcttgccgcattgcatcatgcg
ggacacgagctggtcttggtgtcttccggcgcggttgcggcagggttcggtgcgctgggt
ttcaaaaaacgtccggtcaaaatcgccgacaaacaggcttccgccgccgtcgggcagggg
ctgctgatggaagaatatacggcaaacctgtcttcagacggcatcgtgtccgcacaaatc
ctgctcagccgcgccgactttgccgacaaacgccgctaccaaaatgccggcggcgcactt
tccgtgctgctgcaacgccgcgccgtccccatcatcaatgaaaacgatacggtttcggtt
gaggaattgaaaatcggcgacaacgacacattgagtgcgcaagtggcggcgatgatacag
gcagacctcttggtgctgctgaccgacatagacggtctttacaccggcaacccgaacagc
aatcccgatgccgtacggctggacaaaatcgaacacatcaaccatgaaatcatcgaaatg
gcgggcggctcgggttcggcaaacggcacaggcggtatgctgactaaaatcaaagcggcg
acgattgcgaccgagtccggcgtaccggtctatatctgttcctcgctcaaacccgatgca
cttgccgaagcggcagataatcaggcggacggctcgtttttcgtcccccgtgccaaaggt
ttgcggacgcagaagcaatggctggcgttctattccgaaagcaggggcggcgtttatgtg
gacgaaggtgcggaacacgctttgtccgaacagggaaaaagcctgctgatgtcgggcatt
gccggaatcgaagggcatttttcccgtatggacaccgtaaccgtgtacagcaaggcaacc
aaacagcctttgggcaaagggcgagtcctgttcggctctgccgccgccgaagacctgctc
aaattgcgtaaggcgaaaggcgtgttcatccatcgggacgactggatttccatcacgccc
gaaatacgcctgcttctgaccgaattttag

DBGET integrated database retrieval system