KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1401Help
Entry
NMA1401           CDS       T00031                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMA1401
Enzymes [BR:nma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NMA1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1300324..1302069)
Genome map
AA seq 581 aa AA seqDB search
MERQTDEFAQAAARAAIRFLEHYASSGDEVLANCTERLFQALQNGHSFIRLSGGEADALS
ALAPVVGTSAAPLILEGRRLFLGRMWQLEYDLAAEIKRLAAADTSAPDAAGARQNLAKWF
QGTGSEGQRDAAALALLQSFMVITGGPGTGKTTTVAKLLALICGKDENLPNIALAAPTGK
AAAHMARALHRAINGFDALEAVRRHLLKLEGQTVHRLLKLRPPKMQAAFNPVYPLPFDVL
VIDEASMLDTALMLQLLKAVKTGARVILLGDENQLPSVGIGAVLSVLSQKTVLDGETHQR
LAGFLPEHGFSVSANPPVLAQNTAHLSFSHRFGDNSGIGCLARAAVSGDEGAWALFDRFP
DELEHSECSPNARVERLYRAHKAYWQAVKDGNIEAAYAGISDIVVLAAWRQDAEDFNEAY
CRHVRRKMNIPEHLAYFAGEPIMIRQNDYALELFNGDIGLIMEDVGRQGSLAAYFADADG
FKKVAVSCLPEFEPAFAMTVHKSQGSEYREVWLLPPSAAPSDEGDDALSGLSKELLYTAI
TRAREKFVFFGGEETFRQAAATVKTRQTALGSMLERVFSQG
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggaacggcagacagatgaatttgcccaagcggcggcaagggcggcaatccgttttttg
gaacactatgcgagttccggcgacgaagtgcttgcaaactgcaccgaacgcctgtttcag
gcattgcaaaacggtcattcgtttatccgtttgagcggtggcgaggctgacgcgctgtcg
gcactcgcacccgttgtcggaacatccgccgcgcctttgattttggaaggcagaaggctg
tttttgggcaggatgtggcagttggaatacgatttggctgccgagataaaacgcttggcg
gcagccgacacgtccgcccccgacgcggcaggcgcgaggcaaaacctcgcaaaatggttt
caaggcacgggcagcgaagggcagcgcgatgccgccgccttggcactgttgcagtctttt
atggtgattaccggcgggccgggaacgggcaaaacgacaacggttgccaaactgctggcg
ctgatttgcggtaaagacgaaaatcttcccaacatcgcgcttgccgcaccgacgggcaaa
gcggcggcacatatggcgcgcgcgctgcaccgtgcaatcaacggttttgacgcgctggag
gccgtccgccgccatttgctcaaactggaagggcaaaccgtccaccgactgctgaagctg
cgcccgcccaaaatgcaggcggcgttcaaccctgtttacccgctgccgtttgacgtattg
gttatcgatgaagcctctatgctggatacggcattgatgctgcaacttttaaaagcggtc
aaaaccggcgcgcgcgtgattctgctgggggatgaaaaccagctcccgtccgtcggaata
ggggcggtgctgtccgttttgtcacaaaaaaccgttttggacggagaaacgcaccaaagg
ctggccggcttccttccggaacacggtttcagcgtcagcgcaaatccacccgtgttggcg
caaaacaccgcccatctgtcgttcagccaccgcttcggcgacaacagcggcatcggctgc
cttgcccgtgccgccgtatcgggcgatgaaggggcgtgggcattgtttgaccggtttccg
gacgaactggaacattcggaatgcagtccgaacgctcgagtcgaaaggttgtaccgggca
cacaaagcctattggcaggcggtaaaagacggcaatatcgaagccgcatacgcgggcatt
tcggatatcgtggttctggcagcttggcggcaggatgcggaagacttcaacgaagcctat
tgccgccatgtacgccgcaaaatgaacataccggaacatttggcatattttgccggagag
ccgattatgatcaggcagaacgactacgcgcttgaactgttcaacggcgacatcggactg
attatggaagatgtcggacggcagggcagccttgccgcctattttgccgatgcggacgga
tttaaaaaggtagcggtaagctgcctgcccgaatttgaacccgcattcgccatgaccgtc
cacaaaagccaaggttcggaatatcgggaagtctggctgctgccgccttccgccgcacct
tcggacgaaggggacgatgcattgtccggattgagtaaggagctgttatataccgccatt
acccgcgcgagggagaagttcgtattcttcggcggagaagaaaccttccggcaagctgcc
gccactgtcaaaacgcgtcagacggcattgggcagtatgcttgagcgggtattttcacaa
ggataa

DBGET integrated database retrieval system