KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1406Help
Entry
NMA1406           CDS       T00031                                 

Definition
(GenBank) putative recombination protein
  KO
K06187  
recombination protein RecR
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMA1406
DNA repair and recombination proteins [BR:nma03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     NMA1406
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMA1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1304612..1305229)
Genome map
AA seq 205 aa AA seqDB search
MSHKKQDAFQGLIDALKVLPNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVDHCA
RCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGMD
VSAIALDRLAQRLGGGEVEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLGG
ELEYVDAGTLAQAVYERRLIKEGGA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaaaaaacaagatgccttccaaggattgatcgacgcgctgaaggttttaccc
aacgtcgggccgaaatcggcacagcggatagcgtatcatttgctccaacacaagcgcaaa
gaggctgaaaaactggtggatgccttgcagacggcattgaagcaggtcgatcattgcgcg
aggtgcaacacgttttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgcgac
gggcgacggctgatggtggtgcatatgcctgccgacgtgtcgaatatggaagcggcaaac
tgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatggac
gtatccgccatcgcattggacaggctggcgcaacggctgggcggcggggaagtcgaagaa
atcattattgcaaccgcttttaccgcagaaggcaatgcgacggcgtatgtcctgtccgag
ttttttaaaaacctgccttacaaagtcagcaggctgtcgcagggcattcccttgggcggc
gaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacgccgcctgatt
aaagaaggcggggcataa

DBGET integrated database retrieval system