KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1406Help
Entry
NMA1406           CDS       T00031                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMA1406 (recR)
DNA repair and recombination proteins [BR:nma03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMA1406 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1304612..1305229)
Genome map
AA seq 205 aa AA seqDB search
MSHKKQDAFQGLIDALKVLPNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVDHCA
RCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGMD
VSAIALDRLAQRLGGGEVEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLGG
ELEYVDAGTLAQAVYERRLIKEGGA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaaaaaacaagatgccttccaaggattgatcgacgcgctgaaggttttaccc
aacgtcgggccgaaatcggcacagcggatagcgtatcatttgctccaacacaagcgcaaa
gaggctgaaaaactggtggatgccttgcagacggcattgaagcaggtcgatcattgcgcg
aggtgcaacacgttttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgcgac
gggcgacggctgatggtggtgcatatgcctgccgacgtgtcgaatatggaagcggcaaac
tgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatggac
gtatccgccatcgcattggacaggctggcgcaacggctgggcggcggggaagtcgaagaa
atcattattgcaaccgcttttaccgcagaaggcaatgcgacggcgtatgtcctgtccgag
ttttttaaaaacctgccttacaaagtcagcaggctgtcgcagggcattcccttgggcggc
gaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacgccgcctgatt
aaagaaggcggggcataa

DBGET integrated database retrieval system