KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1413Help
Entry
NMA1413           CDS       T00031                                 

Definition
ribulose-phosphate 3-epimerase (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMA1413
   01230 Biosynthesis of amino acids
    NMA1413
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMA1413
   00040 Pentose and glucuronate interconversions
    NMA1413
Enzymes [BR:nma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     NMA1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1312032..1312760)
Genome map
AA seq 242 aa AA seqDB search
MTTYRIAPSILSADFARLGEEVESVIAAGADLIHFDVMDNHYVPNLTFGPMVCAALKPYA
SVPIDVHLMVEPVDDLIQSFAKAGASIITFHPEASRHIDRSLSLIRDMGCQAGLVLNPAT
PVYLLENVLDRLDMVLLMSVNPGFGGQSFIPYTLEKIRQVRAMLDRYEEKSGRRIAIEVD
GGIKTDNIAAAAQAGADTFVAGSAIFGKPDYKAVIDAMRAELEKSGRLNLAPMIEIEMPS
EN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactacttaccgtatcgcacccagcattttatcggcagattttgcacggcttggcgaa
gaggtggaaagcgtcattgcggcaggtgcagatctgatccattttgacgtgatggacaac
cattatgtgccgaacctgaccttcgggcctatggtttgcgcggcgttgaagccttatgca
agcgtgccgatcgatgtgcatctgatggtcgaacccgtggatgacctgattcagtcgttt
gccaaagctggagcatcaatcatcacgttccatcccgaagcgagccgccatattgaccgc
agcttgagcctgattcgggacatgggctgtcaggcggggctggtgttgaatccggcaacg
cccgtatatctgttggaaaacgtattggacaggctggatatggttttgctgatgtcggta
aaccccgggttcggcggtcagagcttcattccgtatactttggaaaaaatcagacaggtt
cgtgccatgcttgaccgctatgaagagaaaagcggcagacgtattgccattgaagtggac
ggcggcatcaaaaccgacaatatcgccgccgccgcccaagccggcgcggatacctttgtt
gccggttctgcgattttcggcaaaccagactataaggcggtgattgatgcgatgagggcg
gaactggaaaaaagcggcaggctgaaccttgcgccaatgattgaaatagaaatgccgtct
gaaaattag

DBGET integrated database retrieval system