KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1440Help
Entry
NMA1440           CDS       T00031                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMA1440 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMA1440 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMA1440 (thrC)
Enzymes [BR:nma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NMA1440 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1333237..1334646
Genome map
AA seq 469 aa AA seqDB search
MKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGREALDKWRGLAYPELAFEIMR
LFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKIQALSNGPTLAFKDMAMQFL
GNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNVFMLSPDGKMSAFQRAQMYS
LQDGNIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVNSINWGRIVAQVVYYFAGYF
KATQSNDEQVSFCVPSGNFGNVCAGHIAKQMGLPVRRLIVATNENDVLDEFFKTGAYRPR
NSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWAEVAAGKGFNLRFALDKVGG
KYGFTSGKSTHADRLATIRQVYEQDQELIDPHTADGVKVAREVREERETVVCLETALAAK
FDATIREAVGDVAIPRPAALEGLENLPQRVQTVPNSADAVKGIIEQTLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattg
atggggcttgcacccgacggcggcctgatgctgccggaacattatccgcaaatcgggcgg
gaagccttggacaaatggcgcggtttggcttatcccgaattggcgtttgaaattatgcgc
ctgttcgttaccgacattccggaggacgatttgcgcgatattctgaaccgtacttacacg
gaagcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaa
atccaagccttgtccaacggcccgacgctggcgttcaaagatatggcgatgcagtttttg
ggcaatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgca
accagcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaaaggtgtgaat
gtatttatgctgtcgcccgatggcaaaatgagcgcgttccaacgtgcgcagatgtacagc
ctgcaagacgggaatatccacaatatcgccgtgaagggtatgtttgacgactgtcaggat
attgtgaaggcggtgcaaaacgatgccgcgttcaaggaaaaataccatatcggtacggtc
aattcgattaactggggacgcatcgtcgcgcaagtggtttattactttgccggctatttc
aaagcgacgcaaagcaatgacgagcaagtcagcttttgcgtgccgagcggcaacttcggc
aacgtttgcgcgggacacattgccaaacaaatgggcctgcctgtccgccgcctgattgtc
gcgaccaatgaaaacgatgtgttggacgagtttttcaaaaccggcgcgtaccgcccgcgc
aacagcgcgcatacttatgttacctccagcccgtcgatggacatttccaaagcgtccaac
ttcgagcgtttcgtgttcgacctgatggatcgcgatcctcaggaaatcaatacgctttgg
gcggaagtggcggcgggtaagggctttaacctgcggtttgccttggacaaagttggcggc
aaatacggctttacctccggcaaatctacccacgccgaccgcctcgccaccatcagacag
gtttacgagcaagaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcc
cgcgaagtgcgtgaagaaagggaaacggtggtttgtttggaaaccgcgttggcggcgaaa
ttcgatgcgaccatacgcgaagccgtcggcgatgtcgccattccgcgtcccgccgcgctg
gaaggtttggaaaacctgccgcaacgcgtgcaaaccgtgccgaacagtgcggatgcggta
aaaggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system