KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1555Help
Entry
NMA1555           CDS       T00031                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00010  Glycolysis / Gluconeogenesis
nma00020  Citrate cycle (TCA cycle)
nma00620  Pyruvate metabolism
nma01100  Metabolic pathways
nma01110  Biosynthesis of secondary metabolites
nma01120  Microbial metabolism in diverse environments
nma01130  Biosynthesis of antibiotics
nma01200  Carbon metabolism
Module
nma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMA1555
   00020 Citrate cycle (TCA cycle)
    NMA1555
   00620 Pyruvate metabolism
    NMA1555
Enzymes [BR:nma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NMA1555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Methyltr_RsmB-F DEC-1_N FAP
Motif
Other DBs
NCBI-ProteinID: CAM08700
UniProt: A0A0U1RJ96
Position
1454683..1456290
Genome map
AA seq 535 aa AA seqDB search
MSIVEIKVPDIGGHENVDIIAVEVKAGDTIAVDDTLITLETDKATMDVPADAAGVVKEVK
VKVGDKISEGGVILTVETGAAAAEAAPAAAEAQPAPAAAPAAAGGATVQVAVPDIGGHTD
VDVIAVEIKVGDTVAEDDTLITLETDKATMDVPCTAAGVVKAVFLKVGDKVSEGSAIIEV
ETVGSAAAAPAQAAQAAAPAAAPPPTAAAAPAAAPAPSAPAAAKIDEAAFAKAHAGPSAR
KLARELGVDLGQVKGTGLKGRIVGDDIKAFVKSVMQGGAAKPAAVGASLGGGLDLLPWPK
VDFSKFGNVEVKELSRIKKISGQNLSRNWVVIPHVTVHEEADMTELEEFRKQLNKEWERE
GVKLSPLAFIIKASVSALKAFPEFNASLDGDNLVLKNYFNIGFAADTPNGLVVPVIKDVD
QKGLKQISQELTELSKKAREGKLKPQEMQGACFTISSLGGIGGTGFTPIVNAPEVAILGV
CKSQIKPVWNGKEFAPRLMCPLSLSFDHRVIDGAAGMRFTVFLANLLKDFRRITL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtagaaatcaaagtccccgatatcggcggtcacgaaaacgtcgacatcatc
gccgtagaagttaaagcgggcgacaccatcgccgttgacgacaccctgattacactggaa
accgacaaagccacgatggatgtgcctgccgatgcggccggtgtcgtgaaagaagtgaaa
gtcaaagtcggcgacaaaatctccgaaggcggcgtaattctgaccgttgaaaccggtgcc
gccgccgccgaagccgccccggctgctgccgaagcacaacctgcacctgctgccgcaccc
gctgccgcaggcggtgcaaccgttcaagtagccgttcccgatatcggcggccataccgat
gtggatgtaatcgccgttgaaatcaaagtgggcgacaccgttgccgaagacgacacgctg
attactttggaaaccgataaagcgacaatggacgtaccttgtaccgctgccggtgtcgtt
aaagccgtattcttaaaagtcggcgacaaagtatccgaaggctctgccattatcgaagta
gaaaccgtcggctctgccgcagcagcccctgctcaagccgctcaagctgccgcaccggct
gccgctccgcctccgactgctgccgccgcacccgccgccgcgcctgcaccttctgcacct
gccgctgccaaaatcgacgaggccgctttcgccaaagcacacgccggcccttccgcacgc
aaactggcgcgcgaattgggcgtggatttgggccaagtcaaaggtaccggcttgaaaggc
cgcatcgtgggcgacgacatcaaagcctttgtgaaatccgtaatgcagggcggcgcggca
aaacctgccgcagtcggcgcgtctttaggcggcggtctggacttgctgccctggcctaaa
gtggacttctccaaattcggtaatgtcgaagttaaagaattgtcccgcattaagaaaatt
tccggtcaaaacctgtctcgcaactgggtggtgattccccacgttaccgtacacgaagaa
gcagatatgaccgagctggaagaattccgcaaacaactgaacaaagaatgggaacgcgaa
ggcgtgaaactgtcaccgttggcgttcatcatcaaagcctccgtttccgcgctgaaagcc
ttccccgaattcaacgcttctctggacggcgacaacttggtgctgaaaaactacttcaac
atcggtttcgcagcagacacgccgaacggcttggttgttccagtaatcaaagacgtggat
caaaaaggcttgaaacaaatcagccaagagctgaccgaattgtctaaaaaagcccgcgaa
ggcaagctcaaaccacaagaaatgcaaggcgcatgctttaccatttccagcttgggcggc
atcggcggcacaggtttcacgccgattgtgaacgctcccgaagtcgccatcttgggcgtg
tgcaaatcccaaatcaaaccggtttggaacggcaaagaattcgctcctcgcctgatgtgc
ccattgagcctgtcctttgaccaccgtgtcatcgacggcgcggccggtatgcgcttcacc
gtattcctggccaacctgttgaaagacttccgccgcattactctgtaa

DBGET integrated database retrieval system