KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1591Help
Entry
NMA1591           CDS       T00031                                 

Definition
type III restriction/modification system enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Brite
Enzymes [BR:nma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     NMA1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1496471..1499293
Genome map
AA seq 940 aa AA seqDB search
MNSINQQKIKRRKKMANNKTLFDWVEDRKSTLEEIEQTDFFALPEFVERNLKYPFFEWQK
SALENFVIFDRASKLKDFPDIKNRPTHLLFNMATGAGKTMMMAALILYYFEKGYRHFLFF
VNQNNIVDKTENNFIDPAHAKFLFTEKILQGDTVIPIRKVEMFSPHSDGIEIKFTSIQKL
YNDIHTERENQTTLADLHKLNLVMLGDEAHHLNAQTKGKKQDELDLEVELKANAGNAEIE
RKGWEHMVLELLLNKNGNPGQNVLLEFTATLPENADVQQKYADKIITKFGLKEFLQKGYT
KEINLVSSTLNKKERVLHALLFAWYRHQIALKYGIANFKPVMLFRSKTIDESKADYSAFL
NWAENVQADDFEFLDTFSGSLNNSDNANEQGKTRTEQALKFMQDNKFGFAHLANWVKQNY
QKHNVIITNSETNKNKTEKTDSETEKLLNNLEAADNPIRAIFTVDRLTEGWDVLNLFDIV
RLYEGQNGGGSNKKSGKTAAATVSEKQLIGRGVRYFPFAFEGKQPNKRKFDNDMQHELRI
LEELFYYTHDEQSRYISELKNELRKDGYLPEKDDDKVLATFKLKSEFADNKDFRELLIWA
NKKIPNPNAKSNNADSLQANPQTLSFQVHGNQLLQETQFTADENDETARQIGTQNNFTQT
IKMSEMERHIFNKALHIKGKNSQSLFHFNRLQSKLDIQNRNELQNNLLKDWQIEFLGLGQ
DKQVRLDDKLAGCLKILEMVEKHLNESDMPFIGTKEFTPKKLWEIFGTPKQKWVKKDDVK
TTIATQNDWYVMNNFAGTGLEEALIQFISARLGDLKSKYDVHLIRNEEVFKLNNFADGEG
FMPDFILLLKDKQKSSSNGVKDFLHYQIFIEPKGEHLVETDGWKEEFLEAITVEYGMDKI
LQKDTPHYRLIGLPFFTDHQKNGQFTESFPLGAASLEKMK
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
gtgaattctatcaatcagcaaaaaatcaagcggagaaaaaagatggcgaataataaaacg
ttatttgattgggtggaagaccgcaaatcaacgctggaagaaatagaacagacagatttt
ttcgcgctgcctgaatttgtagaacgcaatttaaaatatccgttttttgaatggcaaaaa
tcggctttagaaaactttgtgatttttgaccgcgcttcaaaattaaaggatttccctgac
atcaaaaaccgccctacccatttgctgttcaatatggcaacaggtgctggcaaaacgatg
atgatggcggcgttgattttgtattattttgaaaaaggttatcggcattttttgtttttc
gtcaatcaaaataatatcgtggataaaacggaaaataattttattgacccggcgcacgca
aaatttttatttaccgagaagattttgcaaggtgatacggtaattcctattcgcaaagtg
gaaatgttcagcccacattcagacggcattgaaattaaatttaccagcattcaaaaactg
tataacgatatccacaccgagcgagaaaaccaaaccacattggcagatttgcacaaattg
aaccttgtgatgctgggcgatgaagcacaccatttaaacgcacaaaccaaaggcaaaaaa
caagacgagttggatttggaagtggaattaaaagccaatgcaggcaatgccgaaattgaa
cgcaaaggctgggagcatatggttttggaattgttgctcaataaaaatggcaatcccggc
caaaatgtgctgttggaatttaccgccacgctgcctgaaaatgctgacgtgcaacaaaaa
tatgcggacaaaatcatcacaaaatttggcttaaaagagtttttgcaaaaaggttatacc
aaagaaatcaatttggtatccagtacgctgaataagaaagagcgggtgttgcacgcttta
ttatttgcttggtatcgccatcaaatcgcgttgaaatacggcattgccaatttcaagcct
gtgatgttgtttagaagtaagacgattgatgaatcaaaagcggattattcggcattttta
aattgggcagaaaatgtacaagcggatgattttgagtttttagatacgttttcaggcagc
ctgaataatagcgacaacgccaacgaacaaggcaaaacccgaaccgaacaagccctaaaa
tttatgcaggacaataaatttgggtttgcacatttggcaaattgggtgaaacaaaattat
caaaaacataatgtgattattaccaactccgaaaccaacaaaaacaaaactgaaaaaacc
gacagcgaaaccgaaaaattgctaaacaatttggaagcggctgataatccaatccgtgcc
atttttacggtagatagattaaccgaaggttgggacgttctgaatttgtttgatattgtg
cgtttgtatgaagggcaaaatggcggtggttcaaataaaaaatcaggcaaaacggctgcc
gctaccgtatcggaaaagcagttgattggtcgtggcgtgcgttattttccatttgcgttt
gaaggtaaacagccgaataaacgcaaatttgacaacgacatgcaacacgaattgcgtatc
ttggaagaattgttttattacacgcacgatgagcaatcccgctatatttcagaactgaaa
aatgagttgcgaaaagacggttatttgcctgaaaaagacgatgataaggtgttggcaaca
tttaaactcaaatctgaatttgccgataataaggattttagagagttgttaatttgggcg
aataaaaaaatccccaacccaaacgccaaaagcaataatgcagacagcctgcaagccaat
ccgcaaacgctttcattccaagttcacggtaatcaactgttgcaggaaacgcaatttaca
gccgatgaaaatgatgaaacagcccgacaaatcggcacacaaaataattttactcaaacc
ataaaaatgagtgaaatggagcggcacattttcaataaagcattacatatcaaagggaaa
aatagtcaatctttattccatttcaaccgtttgcaaagcaagctcgacattcaaaatcgc
aatgaattgcaaaataacttgttgaaagactggcaaattgaatttttaggattagggcaa
gacaaacaggttcgcttggacgataaacttgcaggctgcctgaaaatcttggaaatggtt
gaaaaacatctgaatgaaagtgatatgccgtttatcggtacaaaagaatttacacctaaa
aaattatgggaaattttcggcacgccaaaacaaaaatgggtcaaaaaagatgatgtaaaa
acgactattgccacgcaaaatgattggtatgtgatgaataattttgccggaacgggtttg
gaagaagcgttaattcaatttatttcagcgcgtttgggcgatttgaaatctaaatatgac
gttcatttaatccgtaatgaagaagtgtttaaattgaataactttgccgatggtgaagga
tttatgccggactttattttattgctgaaagataaacaaaaatcttcttccaatggcgtg
aaggactttttgcattaccaaattttcattgagcccaaaggtgagcatttagtggaaact
gatggatggaaagaagaatttttagaagccatcactgtggaatatgggatggataagatc
ctgcaaaaagatacaccgcattatcgtttgatcggtttaccgttttttactgatcatcag
aaaaatggacaatttacggagtcattccctttaggtgcggcatcgcttgaaaaaatgaag
tag

DBGET integrated database retrieval system