KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1820Help
Entry
NMA1820           CDS       T00031                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NMA1820
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMA1820
Enzymes [BR:nma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NMA1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1767753..1768286)
Genome map
AA seq 177 aa AA seqDB search
MGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLTPQYEALQKLYAQYTAEGLEILD
FPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNH
LFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERFAPSVTPEEIEADIRALL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttacgattttcaaatgaaagatgcagaaggcaatgcggttgatttgtcaggc
tatcgcggcaaggttctgctgattgtcaacacggcaacgcgttgcggtctgaccccgcaa
tacgaggctttgcagaagctgtatgcacaatataccgcagaaggcttggagattttggat
tttccgtgcaaccagttccgcgaacaggctcccgaaagcagcggagaaattgcccaagtg
tgtatgatgaagtttggcacgaagtttaagattttcgacaaaatcgaagtcaatggagca
aataccgcgcccttgtatgcctacctgaaatccgtcaaaccgcaagataaaggcaatcat
ctgtttaaagatttcgtgttgaagctcgcagctttgggagagaagcgcgacgaaggcgac
atcaaatggaactttaccaaattcctcgtcaaccgcgacggcgaagtggtcgagcgtttt
gcgcctagtgttacgcccgaagaaatcgaagccgatattcgggcattgctgtaa

DBGET integrated database retrieval system