KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1996Help
Entry
NMA1996           CDS       T00031                                 

Definition
periplasmic type I secretion system protein
Orthology
K11003  
hemolysin D
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Bacterial secretion system
Module
alpha-Hemolysin/cyclolysin transport system
Class
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:nma03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1934680..1936044)
Genome map
AA seq 454 aa AA seqDB search
MFFSALKSFLSRYITVWRNVWAVRDQLEPPKRTAEEQAFLPAHLELTDTPVSAAPKWAAR
FIMAFALLALLWSWFGKIDIVAAASGKTVSGGRSKTIQPLETVVVKAVHVRDGQHVKQGE
TLAELEAVGTDSDVVQSEQALQAAQLSKLRYEAVLAALESRTVPHIDMAQARSLGLSDAD
VQSAQVLAQHQYQAWAAQDAQLQSALRGHQAELQSAKAQEQKLVSVGAIEQQKTADYRRL
RADNFISEHAFLEQQSKSVSNWNDLESTRGQMRQIQAAIAQAEQNRVLNTQNLKRDTLDA
LRQANEQIDQYRGQTDKAKQRQQLMTIQSPADGTVQELATYTVGGVVQAAQKMMVVAPDD
DKMDVEVLVLNKDIGFVEQGQDAVVKIESFPYTRYGYLTGKVKSVSHDAVSHEQLGLVYT
AVVSLDKHTLNIDGKTVGLGLYGGGVAGQTYLEY
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtttttctccgccctgaaatcctttctttcccgctacattaccgtatggcgcaatgtt
tgggcggtgcgcgaccagttggaaccgcccaaacgcacggcggaagaacaggcgtttttg
cccgcgcatttggaactgaccgatacgccggtctctgccgctccgaaatgggcggcgcgt
tttattatggcgtttgcgcttttggctttgttgtggtcctggttcggcaaaatcgatatt
gtggcggcggcttcgggcaaaacggtgtcgggcgggcgcagcaaaaccatccagccgctg
gaaacggtggtggttaaggcggtacatgtgcgcgacgggcagcatgtgaaacagggagaa
acgctggcggaactggaggctgtgggaacagacagcgatgtggtgcagtcggagcaggct
ttgcaggctgcccaattgtccaaactgcgttatgaagcggtattggcggcattggaaagc
cgtaccgtgccgcatatcgatatggcgcaagcacggtctttaggtctctccgatgccgat
gtgcaatcggcgcaggtgttggcgcagcaccagtatcaggcatgggcggcgcaggatgcg
caattgcagtcggctttgcgcggccatcaggcggaattgcagtcggccaaggcgcaggag
cagaagctggtttcggtgggggcgatcgagcagcagaaaacagcagactaccgccgtttg
cgggccgacaattttatttcggaacatgcgtttttggagcagcagagcaaatcggtcagc
aattggaacgatttggaaagtacgcgcggtcagatgaggcagattcaggcggccattgca
caggcggagcagaatcgggtgctgaatacgcagaacctgaaacgcgatacgctggatgcg
ctgcgccaggcaaacgaacagattgaccaataccgcggccaaacggataaggcaaagcag
cggcagcagctgatgacaatacagtcgcctgcggacggcacggtgcaggaattggccacc
tatacggtgggcggtgtggtgcaggctgcccaaaaaatgatggtggttgcgcccgatgac
gacaaaatggacgtggaagttttggtattgaacaaagacatcggttttgtggaacaggga
caggatgcggtggtgaagattgagagttttccctatacgcgctacggttatctgacgggc
aaggtgaaaagtgtcagccatgatgcggtaagccacgaacagttgggcttggtttatacg
gcggtggtgtcgctggacaaacataccttgaatattgacggcaaaacagttgggcttggt
ttatacggcggtggtgtcgctggacaaacataccttgaatattga

DBGET integrated database retrieval system