KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA2221Help
Entry
NMA2221           CDS       T00031                                 

Definition
(GenBank) Holliday junction DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMA2221
Enzymes [BR:nma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NMA2221
DNA repair and recombination proteins [BR:nma03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NMA2221
    RecFOR pathway proteins
     NMA2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2174247..2174831
Genome map
AA seq 194 aa AA seqDB search
MISRLTGKLVEKNPPQIVIDVNGVGYEADVSMQTFYNLPPVGESVQLFTQLIIREDAHLL
FGFATAEERKTFRQLIKVGGIGAKTALGILSAMTADELAQAVAEEDVKRLSSAPGIGKKT
AERMVLELRGKLVAHAVTDGLFAAAPAADETEDIVGTLLALGYSEREAKAAVKGVPEGTD
VGEGVRLALKNLLK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagactgaccggcaaactggttgaaaaaaaccctccgcaaatcgtcatcgat
gtcaacggtgtcggctatgaggccgacgtatcgatgcagaccttctacaacctgccgccc
gtgggtgaaagcgtacaactgtttacccagcttatcattcgggaagacgcacatctttta
tttggttttgccactgcggaagaacgcaaaacattccgccaactgatcaaggtcggcggc
atcggcgcgaaaacggctttgggcattttgtcggcgatgacggcagacgagctggcgcag
gcggttgcagaagaagatgtcaaacgcctctcctccgccccgggaatcggcaaaaaaacc
gccgaacgcatggttttggaactgcgcggcaagctggtcgcgcatgcggtaacggacggg
ctgtttgccgccgcacccgccgccgacgaaacggaagacatcgtcggcacgctgcttgcg
ctgggttacagcgaacgcgaagcaaaagcggcggtcaaaggcgttccggaggggacggac
gtgggcgaaggcgtgcgccttgctttgaaaaacctgctgaaataa

DBGET integrated database retrieval system