KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0270Help
Entry
NMC0270           CDS       T00458                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmc01100  Metabolic pathways
nmc01110  Biosynthesis of secondary metabolites
nmc01130  Biosynthesis of antibiotics
nmc01230  Biosynthesis of amino acids
Module
nmc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMC0270 (trpC)
Enzymes [BR:nmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NMC0270 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PIG-X
Motif
Other DBs
NCBI-ProteinID: CAM09583
UniProt: A1KRV4
Position
complement(269085..269867)
Genome map
AA seq 260 aa AA seqDB search
MTDILNKILTAKAQEVAAQKAAVNAEHIRALAAEAAPVRSFIGSIRGKHRLNLPAVIAEI
KKASPSKGLIRPDFRPAEIARAYENAGAACLSVLTDEPYFQGSPEYLKQAREAVSLPVLR
KDFIIDEYQVYQARAWGADAVLLIAAALEQEQLERFEAVAHELGMTVLLELHDESELEKC
RNLTTPLWGVNNRNLRTFEVSLDQTLSLLPALEGKTVVTESGITGKADVEFMQSRGVHTF
LIGETFMRADNIEAEVGKLF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcaataaaatccttaccgccaaggcacaggaagttgccgctcaaaaa
gccgccgtcaacgccgaacacatccgcgcacttgccgcagaagccgcgcccgtccgcagc
ttcatcggttcgatacgcggcaaacaccgcctaaacctgcccgccgtcattgccgaaatc
aaaaaggcaagcccgagcaaaggcctgatccgtccggacttccgaccggccgagattgca
cgcgcctatgaaaacgccggggcggcgtgtttgtccgtactgaccgacgaaccctatttc
caaggttcgcccgaatacctcaaacaggcgcgcgaagccgtatcgctgcccgtgctgcgc
aaagacttcatcatcgacgaatatcaggtttatcaggcgcgcgcatggggggcggatgcc
gtcctgctgattgccgcagcactggaacaggaacaattggaacgctttgaagcggtggcg
cacgaattgggcatgaccgtcctgctcgagctgcacgatgaaagcgaattggaaaaatgc
cgcaacctgaccacgccgttgtggggtgtaaacaaccgcaacctgaggacttttgaagtc
tccctcgaccaaaccctgtcgctgctgcccgcgctggaaggcaaaaccgtcgttaccgaa
agcggcattacaggcaaggcggatgtggaatttatgcaatcgcgcggcgtgcataccttc
ctgatcggcgaaacgtttatgcgtgccgacaatattgaggcggaagtaggcaaactcttc
taa

DBGET integrated database retrieval system