KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0336Help
Entry
NMC0336           CDS       T00458                                 

Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Brite
Enzymes [BR:nmc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NMC0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD CMAS Methyltransf_11 Methyltransf_18 Methyltransf_12 Ubie_methyltran Methyltr_RsmB-F Methyltransf_23 Methyltransf_9 MTS Methyltransf_3 Methyltransf_24 Aconitase_2_N Methyltransf_32 DUF938
Motif
Other DBs
NCBI-ProteinID: CAM09646
UniProt: A1KS16
Position
337241..337897
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRELFVDEDLQGLAYADMALPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVSDDIDAEQQNRAKAVLD
GLGLDNIDYVQNNGLTELSAGAPFDAVYVGGAVNLVPEVLKEQLKDGGRMVVIVGRKPVQ
RALLITRKGDVFEEKVLFDTLVAHLDDKDADPFGGFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcaaatccgtccttgggatgta
ttggattttgacgttttggacgctttggcggagattccgcgcgagctttttgtcgatgag
gacttgcagggtttggcgtatgcggatatggcgctgccgcttgccaacggtcataagatg
ctcgagccgaaagtcgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggttcgggctatgcgaccgcgctgttggcaaaattggctggt
cgtgtggtgtcggacgacatcgatgccgaacagcaaaaccgcgccaaagcggtgttggac
ggcttgggtttggacaatatcgattatgtgcaaaacaacgggttgaccgaactttccgca
ggtgcgccgtttgatgcggtttatgtcggcggtgcggtaaaccttgtgcctgaagtgttg
aaagaacagttgaaagatggcggacgcatggtggttatcgtaggccgcaagcctgttcag
cgcgcgcttttgattacgcgcaagggcgatgtgtttgaagagaaggtgctgttcgatacc
ttggtggcgcatttggatgataaggatgccgatccgtttggcggttttcagttttga

DBGET integrated database retrieval system