KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0469Help
Entry
NMC0469           CDS       T00458                                 

Definition
(GenBank) putative hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc00520  Amino sugar and nucleotide sugar metabolism
nmc01100  Metabolic pathways
nmc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMC0469
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    NMC0469
Enzymes [BR:nmc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NMC0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CAM09769
UniProt: A1KSD9
Position
complement(490450..491535)
Genome map
AA seq 361 aa AA seqDB search
MTVPHIPRGPVMADIAAFRLTEEEKQRLLDPAVGGIILFRRNFQNIEQLKTLTAEIKALR
TPELIIAVDHEGGRVQRFIEGFTRLPAMSTLGEIWDKDGASAAETAAGQVGRVLATELSA
CGIDLSFTPVLDLDWGNCPVIGNRSFHHNPEAVAHLALALQKGLAKGGMKSCGKHFPGHG
FVEGDSHLVLPEDRRSLSELEAADLAPFHIMSREGMAAVMPAHVVYPQVDTKPAGFSEIW
LKQILRRDIGFKGVIFSDDLTMEGACGVGGLKERARISFEAGCDIVLVCNRPDLVDELRE
DFRIPDNPALAQRWQYMANTLGSAAAQAVMQTADFQEAQAFVAGLASPQDTAGGVKVGEA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccccatattccgcgcggccccgtcatggcagacattgccgccttccgcctg
accgaagaggaaaagcaacgcctgctcgatcccgccgtaggcggcatcatcctcttccgc
cgcaacttccaaaacatcgaacaactcaaaacactcaccgccgaaatcaaagccctgcgc
acacccgaactcattatcgccgtcgatcacgaaggcggcagggtgcaacgtttcatcgaa
ggcttcacccgcctgcccgcaatgagtacgctcggcgagatttgggacaaagacggcgcg
tccgccgccgaaaccgccgccggacaagtcggccgggttttggcaaccgagctttccgcc
tgcggcatcgatttgtccttcacgcccgtcttagatttggactggggaaactgccccgtc
atcggcaaccgcagtttccaccacaatcccgaagcggtcgcccacctcgccctcgccctt
caaaaaggtttggcaaaaggcggtatgaaatcctgcggcaaacattttcccggacacgga
tttgtcgaaggagacagccatctggtcttgccggaagacaggcgcagcctgtccgaactc
gaagccgccgacctcgcccccttccacattatgagccgcgaaggtatggcggcggttatg
cccgcccacgtcgtttatccacaagtggacacaaagcccgcagggttttccgaaatctgg
ctcaaacaaattttgcgccgcgatatcggattcaaaggcgtgattttctcggacgatttg
actatggagggcgcgtgcggtgtcggcggcctcaaagaacgcgcccgcatttcctttgag
gcaggttgcgacatcgtcctcgtctgcaaccgtcccgaccttgtggacgaactgcgcgaa
gatttccgcattcctgacaatcccgctttggcgcaacgttggcaatatatggccaacacg
ctcggcagtgccgccgcgcaagccgttatgcagacggcggatttccaagaggcgcaagcc
tttgttgccggccttgcctcgccgcaggatacagcgggcggcgtaaaagtcggcgaagcc
ttttaa

DBGET integrated database retrieval system