KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0490Help
Entry
NMC0490           CDS       T00458                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(516795..517637)
Genome map
AA seq 280 aa AA seqDB search
MIQFRLSNTRNHLYMKTKLIKILTPFTVLPLLACGQTPVSNANAEPAVKAEPAVKAKSAG
KSVAASLKARLEKTYSAQDLKVLSVNETPIKGIYEVVVSGKQIIYTDAKGDYMLVGDLIN
VNTRQSLTEERAADLNKIDFASLPLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEK
MTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAET
TSLGEQFGFNGTPTLVFPNGRSQSGYSPMPQLEEIIRKNQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
ttgatacaattccgcctttccaacacgcgcaatcatctttatatgaaaaccaagttaatc
aaaatcttgaccccctttaccgtcctcccgctgctggcttgcgggcaaacgcccgtttcc
aatgccaacgccgaacccgccgtcaaagccgaacccgccgtcaaagccaagtccgccggc
aaatccgttgccgcctctttgaaagcgcgtttggaaaaaacctattccgcccaagatttg
aaagtgttgagcgtcaatgaaacaccgattaaaggcatttacgaagttgtcgtcagcggc
aaacaaatcatctataccgatgccaaaggcgactatatgcttgttggcgacctcatcaac
gtcaacacgcgccaaagcctgactgaagaacgcgccgccgatttgaacaaaatcgacttt
gcttccctgcctttggacaaagccatcaaagaagtgcgcggcaacggcaagctgaaagtc
gccgtcttctccgaccccgattgtccgttctgcaaacgcttggaacacgagtttgaaaaa
atgaccgacgtgacggtttacagctttatgatgcccattgccggcctgcaccctgatgcc
gcgcgcaaggcgcaaatcttatggtgtcagcccgaccgcgccaaagcgtggacggattgg
atgcgtaaaggcaaattcccggtcggcggcagcatctgcgacaatcccgtcgcggaaacc
acttccttgggcgaacaattcggcttcaacggcacgccgaccctcgtcttccccaacggg
cgcagccaaagcggctacagcccgatgccccaactggaggaaatcatccgcaaaaatcaa
taa

DBGET integrated database retrieval system