KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0490Help
Entry
NMC0490           CDS       T00458                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Brite
Enzymes [BR:nmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NMC0490
Secretion system [BR:nmc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NMC0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(516795..517637)
Genome map
AA seq 280 aa AA seqDB search
MIQFRLSNTRNHLYMKTKLIKILTPFTVLPLLACGQTPVSNANAEPAVKAEPAVKAKSAG
KSVAASLKARLEKTYSAQDLKVLSVNETPIKGIYEVVVSGKQIIYTDAKGDYMLVGDLIN
VNTRQSLTEERAADLNKIDFASLPLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEK
MTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAET
TSLGEQFGFNGTPTLVFPNGRSQSGYSPMPQLEEIIRKNQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
ttgatacaattccgcctttccaacacgcgcaatcatctttatatgaaaaccaagttaatc
aaaatcttgaccccctttaccgtcctcccgctgctggcttgcgggcaaacgcccgtttcc
aatgccaacgccgaacccgccgtcaaagccgaacccgccgtcaaagccaagtccgccggc
aaatccgttgccgcctctttgaaagcgcgtttggaaaaaacctattccgcccaagatttg
aaagtgttgagcgtcaatgaaacaccgattaaaggcatttacgaagttgtcgtcagcggc
aaacaaatcatctataccgatgccaaaggcgactatatgcttgttggcgacctcatcaac
gtcaacacgcgccaaagcctgactgaagaacgcgccgccgatttgaacaaaatcgacttt
gcttccctgcctttggacaaagccatcaaagaagtgcgcggcaacggcaagctgaaagtc
gccgtcttctccgaccccgattgtccgttctgcaaacgcttggaacacgagtttgaaaaa
atgaccgacgtgacggtttacagctttatgatgcccattgccggcctgcaccctgatgcc
gcgcgcaaggcgcaaatcttatggtgtcagcccgaccgcgccaaagcgtggacggattgg
atgcgtaaaggcaaattcccggtcggcggcagcatctgcgacaatcccgtcgcggaaacc
acttccttgggcgaacaattcggcttcaacggcacgccgaccctcgtcttccccaacggg
cgcagccaaagcggctacagcccgatgccccaactggaggaaatcatccgcaaaaatcaa
taa

DBGET integrated database retrieval system