KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0628Help
Entry
NMC0628           CDS       T00458                                 

Gene name
trpA
Definition
(GenBank) putative tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMC0628 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMC0628 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMC0628 (trpA)
Enzymes [BR:nmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMC0628 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
650009..650836
Genome map
AA seq 275 aa AA seqDB search
MCFMAYLPIGWKRQMSRIRQAFAALDGGKALIPYITVGDPDIRTTLALMHGMVANGADIL
ELGVPFSDPMADGSVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPVHK
MGYREFAQEAAKAGVDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAPTTTEDRIKTIAE
LAGGFVYYVSLKGVTGAASLDTDEVSRKIEYLHQYIDIPIGVGFGISNAESARKIGRVAD
AVIVGSRIVKEIENNTGNEAAVVGALVKELKDAVR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgtgttttatggcatatttgccgataggatggaagagacaaatgagcagaatccggcag
gcttttgccgctttggatggcggaaaggcattgattccctatattacggtgggcgacccc
gatattcggacaactttggcattgatgcacggcatggttgcaaacggtgcggatattttg
gagttgggcgtgccgttttccgatccgatggcagacgggtcggttattcagcgtgcggcg
gagcgggcgttggcaaacgggatttcgctgcgcgatgtcttggatgtcgtcagaaaattc
cgtgaaaccgacacgcaaacgccggttgttttgatgggatatttgaaccctgtacataag
atgggttatcgggagtttgctcaggaagccgcaaaggcgggtgtggacggcgtgttgacg
gtggattcccctgtcgaaaccatcgatccgctctatcgcgagctgaaggataacggggtc
gactgtattttcctgattgcgccgacgacgacggaagaccgtattaaaaccattgccgag
ctggcaggcggatttgtctattatgtttcgctcaagggcgtaacgggcgcggcaagtttg
gatacggatgaggtttcgcgtaaaatagagtatttgcatcagtatatcgatattcccatc
ggtgtcggtttcggcatcagcaatgcggaaagtgcacgcaaaatcggccgggttgccgac
gcagttattgtcggcagccggattgtgaaagaaatcgaaaacaatacaggcaacgaggct
gcggtcgtcggtgctttggtcaaagagttgaaggatgccgtgcgctga

DBGET integrated database retrieval system