KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0628Help
Entry
NMC0628           CDS       T00458                                 

Gene name
trpA
Definition
(GenBank) putative tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc00260  Glycine, serine and threonine metabolism
nmc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmc01100  Metabolic pathways
nmc01110  Biosynthesis of secondary metabolites
nmc01130  Biosynthesis of antibiotics
nmc01230  Biosynthesis of amino acids
Module
nmc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMC0628 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMC0628 (trpA)
Enzymes [BR:nmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMC0628 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth Peripla_BP_6 ZnuA
Motif
Other DBs
NCBI-ProteinID: CAM09921
UniProt: A1KSU0
Position
650009..650836
Genome map
AA seq 275 aa AA seqDB search
MCFMAYLPIGWKRQMSRIRQAFAALDGGKALIPYITVGDPDIRTTLALMHGMVANGADIL
ELGVPFSDPMADGSVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPVHK
MGYREFAQEAAKAGVDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAPTTTEDRIKTIAE
LAGGFVYYVSLKGVTGAASLDTDEVSRKIEYLHQYIDIPIGVGFGISNAESARKIGRVAD
AVIVGSRIVKEIENNTGNEAAVVGALVKELKDAVR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgtgttttatggcatatttgccgataggatggaagagacaaatgagcagaatccggcag
gcttttgccgctttggatggcggaaaggcattgattccctatattacggtgggcgacccc
gatattcggacaactttggcattgatgcacggcatggttgcaaacggtgcggatattttg
gagttgggcgtgccgttttccgatccgatggcagacgggtcggttattcagcgtgcggcg
gagcgggcgttggcaaacgggatttcgctgcgcgatgtcttggatgtcgtcagaaaattc
cgtgaaaccgacacgcaaacgccggttgttttgatgggatatttgaaccctgtacataag
atgggttatcgggagtttgctcaggaagccgcaaaggcgggtgtggacggcgtgttgacg
gtggattcccctgtcgaaaccatcgatccgctctatcgcgagctgaaggataacggggtc
gactgtattttcctgattgcgccgacgacgacggaagaccgtattaaaaccattgccgag
ctggcaggcggatttgtctattatgtttcgctcaagggcgtaacgggcgcggcaagtttg
gatacggatgaggtttcgcgtaaaatagagtatttgcatcagtatatcgatattcccatc
ggtgtcggtttcggcatcagcaatgcggaaagtgcacgcaaaatcggccgggttgccgac
gcagttattgtcggcagccggattgtgaaagaaatcgaaaacaatacaggcaacgaggct
gcggtcgtcggtgctttggtcaaagagttgaaggatgccgtgcgctga

DBGET integrated database retrieval system