KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0628Help
Entry
NMC0628           CDS       T00458                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nmc00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nmc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
650051..650836
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALDGGKALIPYITVGDPDIRTTLALMHGMVANGADILELGVPFSDPMADGS
VIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPVHKMGYREFAQEAAKAG
VDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGV
TGAASLDTDEVSRKIEYLHQYIDIPIGVGFGISNAESARKIGRVADAVIVGSRIVKEIEN
NTGNEAAVVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttggatggcggaaaggcattgattccctat
attacggtgggcgaccccgatattcggacaactttggcattgatgcacggcatggttgca
aacggtgcggatattttggagttgggcgtgccgttttccgatccgatggcagacgggtcg
gttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctgcgcgatgtcttg
gatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgttttgatgggatat
ttgaaccctgtacataagatgggttatcgggagtttgctcaggaagccgcaaaggcgggt
gtggacggcgtgttgacggtggattcccctgtcgaaaccatcgatccgctctatcgcgag
ctgaaggataacggggtcgactgtattttcctgattgcgccgacgacgacggaagaccgt
attaaaaccattgccgagctggcaggcggatttgtctattatgtttcgctcaagggcgta
acgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagagtatttgcatcag
tatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaaagtgcacgcaaa
atcggccgggttgccgacgcagttattgtcggcagccggattgtgaaagaaatcgaaaac
aatacaggcaacgaggctgcggtcgtcggtgctttggtcaaagagttgaaggatgccgtg
cgctga

DBGET integrated database retrieval system