KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0650Help
Entry
NMC0650           CDS       T00458                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMC0650 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMC0650 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMC0650 (trpB)
Enzymes [BR:nmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMC0650 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
668641..669843
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGFFGEHGGLFVSETLIPALQELADAYKAAKNDPEFWEAFRHDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVESGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAIGRQPDVAVACVGGGS
NAIGLFHPYIGEENVRLVGVEAGGLGVNTPDHAAPITSGAPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEGIIPALESSHA
VAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactaccacgcgcccgacgagaagggctttttcggcgaacacggcgggctgttc
gtgtccgagaccctgattccggctttgcaagagctggcggatgcctataaggcagcgaaa
aacgatcctgaattttgggaagcgttccgccatgatttgaaacattatgtcggcaggccc
agccccgtttaccacgccgcgcggttgtccgaacatctgggcggtgcgcaaatctggttg
aagcgcgaagacttgaaccacaccggcgcgcacaaagtcaacaacaccatcggtcaggca
ctgttggcaaaacgcatgggtaaaaaacgcgtcatcgccgaaaccggcgcgggtcagcac
ggcgtggcgagtgccaccgttgccgcacgcttcggtatgacttgcgacgtgtatatgggc
gcggacgacatccaacgccaaatgcccaacgtgttccgtatgaaattattgggtgcgaac
gtggttggtgtagaaagcggcagccgcacgctgaaagacgcgatgaacgaagccatgcgc
gaatgggtcgcccgcgtggacgacacgttctacatcatcggtaccgccgccggccccgcg
ccgtatcccgaaatggtgcgcgatttccaatgcgtgattggcaacgaagctaaagcgcag
atgcaggaagccatcggcagacagcccgacgttgccgttgcctgcgtgggcggcggatcg
aacgccatcggtttgttccacccgtatatcggcgaagaaaacgtgcgcctcgtcggcgtg
gaggctggcggtttgggcgtgaacacccccgatcacgccgcgccgattacttcgggcgca
ccgattggcgtattgcacggtttccgcagctatctgatgcaggacgaaaacggtcaggtt
ttgggtacgcactctgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacactgttgccaaagacgacgaagcactcgaa
gcctttgacttgctctgccgcttcgagggcatcatccccgcgctcgaatccagccacgcc
gttgcttgggcggtgaaaaacgcgccgaaaatgggcaaagaccaagtgattctggtcaac
ctatccggtcgtggcgacaaagacatcaataccgtcgcgaagctcaaagggattaaactg
taa

DBGET integrated database retrieval system