KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0926Help
Entry
NMC0926           CDS       T00458                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc00020  Citrate cycle (TCA cycle)
nmc00190  Oxidative phosphorylation
nmc00650  Butanoate metabolism
nmc01100  Metabolic pathways
nmc01110  Biosynthesis of secondary metabolites
nmc01120  Microbial metabolism in diverse environments
nmc01130  Biosynthesis of antibiotics
nmc01200  Carbon metabolism
Module
nmc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMC0926 (sdhD)
   00650 Butanoate metabolism
    NMC0926 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMC0926 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: CAM10203
UniProt: A1KTL7
Position
924886..925212
Genome map
AA seq 108 aa AA seqDB search
MTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFTQVSFI
AVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSIKVIWG
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggtgcccattacggtttgcgcgattgggcgatgcaacgtgcgactgcggttatt
atgttgatttataccgttgcacttttagtggttctattttccctgcctaaagaatattcg
gcatggcaggcattttttagtcaaacttgggtaaaagtatttacccaagtgagcttcatc
gccgtattcttgcacgcttgggtgggtatccgcgatttgtggatggactatatcaaaccc
ttcggcgtgcgtttgtttttgcaggttgccaccatcgtctggctggtcggctgcttggtg
tattcaattaaagtaatttgggggtaa

DBGET integrated database retrieval system