KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0935Help
Entry
NMC0935           CDS       T00458                                 

Gene name
sucC
Definition
(GenBank) putative succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc00020  Citrate cycle (TCA cycle)
nmc00640  Propanoate metabolism
nmc00660  C5-Branched dibasic acid metabolism
nmc01100  Metabolic pathways
nmc01110  Biosynthesis of secondary metabolites
nmc01120  Microbial metabolism in diverse environments
nmc01130  Biosynthesis of antibiotics
nmc01200  Carbon metabolism
Module
nmc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMC0935 (sucC)
   00640 Propanoate metabolism
    NMC0935 (sucC)
   00660 C5-Branched dibasic acid metabolism
    NMC0935 (sucC)
Enzymes [BR:nmc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NMC0935 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAM10212
UniProt: A1KTM6
Position
936137..937303
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKELLAGYGLPVQGGILAHNGEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAKEVAESLIGTNLVTYQTDANGQPVNSVLVCEDMYPVQTELYLGAVVDRSTR
RITFMASTEGGVEIEKVAAETPEKIFKVTVDPLVGLQPCQAREVAFQLGLKDKQINEFVK
LMTGAYKAFVENDFALFEVNPLAVRENGALACVDGKIGIDSNALYRLPKIAELRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKDRVV
EAFKLILEDKSVQGVLINIFGGIVRCDMIAEAIVAAVKEINVDVPVVVRLEGNNAELGAK
ILNESGLKLTSADGLNDAAEKIVAAVNA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggctaaagaactgctggctggctacggtttgcccgtacaa
ggcggtattttggcacacaacggcgaagaagccgctgcagcttacgacaaattgggcggc
aaattcgctgttgtcaaagcacaagtacacgccggcggccgcggtaaagcgggcggcgta
aaagtcgttaaaagccgcgaagaagctaaagaagtggctgaaagcctgattggcaccaac
ttggtaacttaccaaactgatgccaacggccaacctgtcaacagcgttttggtttgcgaa
gacatgtatccggttcaaaccgagctgtacttgggcgcagtggttgaccgttctacccgc
cgcattacattcatggcctctaccgaaggcggcgtggaaatcgaaaaagttgctgccgaa
actcctgaaaaaatcttcaaagtaaccgttgatccgctggtcggcctgcaaccttgccaa
gctcgcgaagttgcgttccaactgggcttgaaagacaaacaaatcaacgagttcgtcaaa
ctgatgaccggtgcgtacaaagcgtttgtcgaaaatgacttcgccctgtttgaagtcaac
ccgctggcagttcgcgaaaacggcgcgctcgcctgcgtggacggcaaaatcggcatcgac
agcaacgcgctctaccgcctgccgaaaatcgccgaattgcgcgacaaatctcaagaaaac
gaacgcgagttgaaagcttctgaatttgacctgaactatgttgccctggaaggcaacatc
ggctgtatggtgaacggtgccggtttggcgatggccactatggacatcatcaaactgaaa
ggcggccaacctgccaacttcttggacgttggcggcggcgcaaccaaagaccgcgtggtt
gaagcgttcaaactgattctggaagacaaatccgttcaaggcgtattgatcaacatcttc
ggcggtatcgtacgttgcgacatgattgcggaagccatcgtggcagccgttaaagaaatc
aacgtcgacgttcctgtcgttgttcgtttggaaggcaacaacgccgaactcggcgcgaaa
atcctgaacgaatcaggtctgaaactgacttctgcagacggcctgaatgacgcagccgaa
aaaattgtcgcagccgtaaacgcctaa

DBGET integrated database retrieval system