KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC1033Help
Entry
NMC1033           CDS       T00458                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMC1033 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMC1033 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NMC1033 (proB)
Enzymes [BR:nmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NMC1033 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1022015..1023124)
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSITHSDGSLSRGKIQTITRQLAALHHAGHELVLVSSGAVAAGFGALG
FKKRPVKIADKQASAAVGQGLLMEEYTANLSSDGIVSAQILLSRADFADKRRYQNAGGAL
SVLLQRRAVPIINENDTVSVEELKIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNS
NPDAVRLDKIEHINHEIIEMAGGSGSANGTGGMLTKIKAATIAAESGVPVYICSSLKPDA
LAEAAEHQADGSFFVPRAKGLRTQKQWLAFYSESRGSVYVDEGAEHALSEQGKSLLMSGI
AGIEGHFSRMDTVTVYSKATKQPLGKGRVLFGSAAAEDLLKSRKAKGVFIHRDDWISITP
EIRLLLTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaagaatcgtatttaaagtcggcacatcttcgattacccattcggacggc
agtctctcgcgcggcaaaatccaaaccatcacccgccagcttgccgcattgcatcatgcg
ggacacgagctggtcttggtgtcttccggcgcggttgcggcagggttcggtgcgctgggt
ttcaaaaaacgtccggtcaaaatcgccgacaaacaggcttccgccgccgtcgggcagggg
ctgctgatggaagaatatacggcaaacctgtcttcagacggcatcgtgtccgcacaaatc
ctgctcagccgcgccgactttgccgacaaacgccgctaccaaaatgccggcggcgcactt
tccgtgctgctgcaacgccgcgccgtccccatcatcaatgaaaacgatacggtttcggtt
gaggaattgaaaatcggcgacaacgacacattgagtgcgcaagtggcggcgatgatacag
gcagacctcttggtgctgctgaccgacatagacggtctttacacgggcaacccgaacagc
aatcccgatgccgtacggctggacaaaatcgaacacatcaaccatgaaatcatcgaaatg
gcgggcggatcgggttcggcaaacggcacgggcggtatgctgaccaaaatcaaagcggca
accatcgccgccgaatccggcgtaccggtgtatatctgttcctcgctcaaacccgatgca
cttgccgaagctgccgaacatcaggcggacggctcgtttttcgtcccccgtgccaaaggt
ttgcggacgcagaagcaatggctggcgttctattccgaaagccggggcagcgtttatgtg
gacgaaggtgcggaacacgctttgtccgaacaggggaaaagcctgctgatgtcgggcatt
gccggaatcgaagggcatttttcccgtatggacaccgtaaccgtgtacagcaaggcaacc
aaacagcccctgggcaaagggcgcgtcctgttcggttctgccgccgccgaagacctgctc
aaatcgcgtaaggcgaaaggcgtgttcatccatcgggacgactggatttccatcacgccc
gaaatacgcctgcttctgaccgaattttag

DBGET integrated database retrieval system