KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC1311Help
Entry
NMC1311           CDS       T00458                                 

Definition
type III restriction/modification system enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1299659..1302475
Genome map
AA seq 938 aa AA seqDB search
MNSINQQKIKRRKKMANNKTLFDWVEDRKSTLEEIEQTDFFALPEFVERNLKYPFFEWQK
SALENFVIFDRASKLKDFPDIKNRPTHLLFNMATGAGKTMMMAALILYYFEKGYRHFLFF
VNQNNIVDKTENNFIDPAHAKFLFTEKILQGDTVIPIRKVEMFSPHSDGIEIKFTSIQKL
YNDIHTERENQTTLADLHKLNLVMLGDEAHHLNAQTKGKKQDELDLEVELKANAGNAEIE
RKGWEHMVLELLLNKNGNPGQNVLLEFTATLPENADVQQKYADKIITKFGLKEFLQKGYT
KEINLVSSTLNKKERVLHALLFAWYRHQIALKYGIANFKPVMLFRSKTIDESKADYSAFL
NWAENVQADDFEFLDTFSGSLNNSDNANEQGKTRTEQALKFMQENGFEFAHLANWVKQNY
QKHNVIITNSETNKNKTEKTDSETEKLLNNLEAADNPIRAIFTVDRLTEGWDVLNLFDIV
RLYEGQNGGGSNKKSGKTAAATVSEKQLIGRGVRYFPFAFEGKQPNKRKFDNDMQHELRI
LEELFYYTHDEQSRYISELKNELRKDGYLPEKDDDKVLATFKLKSEFADNKDFRELLIWA
NKKIPNPNAKSNNADSLQANPQTLSFQIHGNQLLQETQFTADENDETARQIGTQNNFTQT
IKMSEMERHIFNKALHIKGKNSQSLFHFDRLQSKLNIQNRNELQNNLLKDWQIEFLGLGQ
DKQVRPDDKLAGCLKILEMVEKHLNESDMPFIGTKEFTPKKLWEIFGTPKQKWVKKDDVK
TTIATQNDWYVMDNFAGTGLEEALIQFISARLGDLKSKYDVHLIRNEEVFKLNNFADGEG
FMPDFILLLKDKQKSSSNGVNDFLHYQIFIEPKGEHLVETDGWKEEFLEAITVEYGMDKI
LQKDTPHYRLIGLPFFTDHQKNGQFTESFPLGAASLEK
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
gtgaattctatcaatcagcaaaaaatcaagcggagaaaaaagatggcgaataataaaacg
ttatttgattgggtggaagaccgcaaatcaacgctggaagaaatagaacagacagatttt
ttcgcgctgcctgaatttgtagaacgcaatttaaaatatccgttttttgaatggcaaaaa
tcggctttagaaaactttgtgatttttgaccgcgcttcaaaattaaaggatttccctgac
atcaaaaaccgccctacccatttgctgttcaatatggcaacaggtgctggcaaaacgatg
atgatggcggcgttgattttgtattattttgaaaaaggttatcggcattttttgtttttc
gtcaatcaaaataatatcgtggataaaacggaaaataattttattgacccggcgcacgca
aaatttttatttaccgagaagattttgcaaggtgatacggtaattcctattcgcaaagtg
gaaatgttcagcccacattcagacggcattgaaattaaatttaccagcattcaaaaactg
tataacgatatccacaccgagcgagaaaaccaaaccacattggcagatttgcacaaattg
aaccttgtgatgctgggcgatgaagcacaccatttaaacgcacaaaccaaaggcaaaaaa
caagacgagttggatttggaagtggaattaaaagccaatgcaggcaatgccgaaattgaa
cgcaaaggctgggagcatatggttttggaattgttgctcaataaaaatggcaatcccggc
caaaatgtgctgttggaatttaccgccacgctgcctgaaaatgctgacgtgcaacaaaaa
tatgcggacaaaatcatcacaaaatttggcttaaaagagtttttgcaaaaaggttatacc
aaagaaatcaatttggtatccagtacgctgaataagaaagagcgggtgttgcacgcttta
ttatttgcttggtatcgccatcaaatcgcgttgaaatacggcattgccaatttcaagcct
gtgatgttgtttagaagtaagacgattgatgaatcaaaagcggattattcggcattttta
aattgggcagaaaatgtacaagcggatgattttgagtttttagatacgttttcaggcagc
ctgaataatagcgacaacgccaacgaacaaggcaaaacccgaaccgaacaagccctaaaa
tttatgcaggaaaatggctttgagtttgcacatttggcaaattgggtgaaacaaaattat
caaaaacataatgtgattattaccaactccgaaaccaacaaaaacaaaactgaaaaaacc
gacagcgaaaccgaaaaattgctaaacaatttggaagcggctgataatccaatccgtgcc
atttttacggtagatagattaaccgaaggttgggacgttctgaatttgtttgatattgtg
cgtttgtatgaagggcaaaatggcggtggttcaaataaaaaatcaggcaaaacggctgcc
gctaccgtatcggaaaagcagttgattggtcgtggcgtgcgttattttccatttgcgttt
gaaggtaaacagccgaataaacgcaaatttgacaacgacatgcaacacgaattgcgtatc
ttggaagaattgttttattacacgcacgatgagcaatcccgctatatttcagaactgaaa
aatgagttgcgaaaagacggttatttgcctgaaaaagacgatgataaggtgttggcaaca
tttaaactcaaatctgaatttgccgataataaggattttagagagttgttaatttgggcg
aataaaaaaatccccaacccaaacgccaaaagcaataatgcagacagcctgcaagccaat
ccgcaaacgctttcattccaaattcacggcaatcaattgttgcaggaaacgcaatttaca
gccgatgaaaatgatgaaacagcccgacaaatcggcacacaaaataattttactcaaacc
ataaaaatgagtgaaatggagcggcacattttcaataaagcattacatatcaaagggaaa
aatagtcaatctttattccattttgaccgcctgcaaagcaaactcaacattcaaaatcgc
aatgaattgcaaaataacttgttgaaagactggcaaattgaatttttaggattagggcaa
gacaaacaggttcgcccggatgataaacttgcaggctgcctgaaaatcttggaaatggtt
gaaaaacatctgaatgaaagtgatatgccgtttatcggtacaaaagaatttacacctaaa
aaattatgggaaattttcggcacgccaaaacaaaaatgggtcaaaaaagatgatgtaaaa
acgactattgccacgcaaaatgattggtatgtgatggataattttgctggaacgggtttg
gaagaagcgttaattcaatttatttcagcgcgtttgggcgatttgaaatctaaatatgac
gttcatttaatccgtaatgaagaagtgtttaaattgaataactttgccgatggtgaagga
tttatgccggactttattttattgctgaaagataaacaaaaatcttcttccaatggtgtg
aacgactttttgcattaccaaattttcattgagcccaaaggtgagcatttagtggaaact
gatggatggaaagaagaatttttagaagccatcactgtggaatatgggatggataagatc
ctgcaaaaagatacaccgcattatcgtttgatcggtttaccgttttttactgatcatcag
aaaaatggacaatttacggagtcattccctttaggtgcggcatcgcttgaaaaatag

DBGET integrated database retrieval system