KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC1488Help
Entry
NMC1488           CDS       T00458                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMC1488 (holC)
   00240 Pyrimidine metabolism
    NMC1488 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NMC1488 (holC)
   03430 Mismatch repair
    NMC1488 (holC)
   03440 Homologous recombination
    NMC1488 (holC)
Enzymes [BR:nmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NMC1488 (holC)
DNA replication proteins [BR:nmc03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NMC1488 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1504936..1505376)
Genome map
AA seq 146 aa AA seqDB search
MPKATFYTHVAQVPIFTCRLIARAIRDGGRILVWSDSFGRLQELDKMLWQYEAESFIPHE
IWEMEEAMPSETSVLLACGGNPPRIPEGMTVLNLSDGFWNTAPVLPARVLEIVGNSLEDL
ADARERFTAYRRSGFAIEHHGMEGKA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagccaccttttacacgcacgttgcccaagttccgattttcacctgccgcctg
attgcccgtgcgattcgggacggcggcaggatactggtgtggtccgattcgttcgggcgg
cttcaggaattggacaaaatgctttggcaatacgaagccgagagtttcattccgcacgaa
atttgggaaatggaagaagccatgccgtctgaaacatccgtcctgcttgcttgcggcggc
aatccgccccgaattcccgaaggcatgactgttttgaacctgtccgacggtttttggaac
accgctccggtcttgcccgcgcgcgttttggaaatcgtcggcaacagcttggaagatctc
gccgacgcgcgcgaacgctttaccgcctaccgccgaagcggttttgccatcgaacatcac
ggcatggagggcaaggcataa

DBGET integrated database retrieval system