KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC1503Help
Entry
NMC1503           CDS       T00458                                 

Gene name
hisB
Definition
imidazoleglycerol-phosphate dehydratase (EC:4.2.1.19)
Orthology
K01693  
imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMC1503 (hisB)
  Amino acid metabolism
   00340 Histidine metabolism
    NMC1503 (hisB)
Enzymes [BR:nmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     NMC1503 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1523254..1523988
Genome map
AA seq 244 aa AA seqDB search
MAKLEKHTGKPKGWLDRKHRERTVPETAAESTGTAETQIAETASAAGCRSVTVNRNTCET
QITVSINLDGSGKSRLDTGVPFLEHMIDQIARHGMIDIDISCKGDLHIDDHHTAEDIGIT
LGQAIRQALGDKKGIRRYGHSYVPLDEALSRVVIDLSGRPGLVYNIEFTRALIGRFDVDL
FEEFFHGIVNHSMMTLHIDNLSGKNAHHQAETVFKAFGRALRMAVEHDPRMAGQTPSTKG
TLTA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactcgaaaaacacaccggcaaacccaaaggctggctcgacagaaaacaccgc
gaacgcactgtccccgaaaccgccgcagaaagcaccggaactgccgaaacccaaattgcc
gaaaccgcatctgctgccggctgccgcagcgttaccgtcaaccgcaatacctgcgaaacc
caaatcaccgtctccatcaacctcgacggcagcggcaaaagcaggctggataccggcgta
cccttcctcgaacacatgatcgatcaaatcgcccgccacggcatgattgacatcgacatc
agctgcaaaggcgacctgcacatcgacgaccaccacaccgccgaagacatcggcatcaca
ctcggacaagcaatccggcaggcactcggcgacaaaaaaggcatccgccgttacggacat
tcctacgtcccgctcgacgaagccctcagccgcgtcgtcatcgacctttccggccgcccc
ggactcgtgtacaacatcgaatttacccgcgcactaatcggacgtttcgatgtcgatttg
tttgaagaatttttccacggcatcgtcaaccacagtatgatgaccctgcacatcgacaac
ctcagcggcaaaaacgcccaccatcaggcggaaaccgtattcaaagccttcgggcgcgcc
ctgcgtatggcagtcgaacacgacccgcgcatggcaggacagaccccctcgaccaaaggc
acgctgaccgcataa

DBGET integrated database retrieval system