KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC2152Help
Entry
NMC2152           CDS       T00458                                 

Gene name
kdtA
Definition
3-deoxy-D-manno-octulosonic-acid transferase (EC:2.-.-.-)
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMC2152 (kdtA)
Enzymes [BR:nmc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     NMC2152 (kdtA)
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     NMC2152 (kdtA)
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     NMC2152 (kdtA)
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     NMC2152 (kdtA)
Glycosyltransferases [BR:nmc01003]
 Polysaccharide
  Bacterial polysaccharide
   NMC2152 (kdtA)
Lipopolysaccharide biosynthesis proteins [BR:nmc01005]
 Core region
  NMC2152 (kdtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2192048..2193385)
Genome map
AA seq 445 aa AA seqDB search
MIPLPKCRPNRSDGICFAGNRKMFQWLYDVLWLLAPIWIRRYLDKRSGSAPAYRAHRGER
FGKPYPNPVTGAVWIHAVSVGETRAAQPLIRELRQRFPDAPLLMTQMTPTGRETAQVLFP
DAQCRYLPYDKKTWVRQFLREHRPMFGVLMETEIWPNLMKECRRAGVPLFLANARLSEKS
LNGYLKVRSLIRPAVASLTGCLVQTEADAARLAKLGAASVQVCGNTKYDLMPSEQMKTLA
GQFEKRIGDRPVAVCGSTRVYRGEDEAEKLLAAWQQYRGDALLVVVPRHPEHFQTAFETA
KRFGFKVQRRSDGLPVEPDTQVWIGDSMGELYAYYLCADVAFVGGSLVDSGCQNIIEPLS
CGVPTIFGFSTYNFSEACRHALASGAAVQVESADAWREAVEKTLSYEGGGMQMQARVDSF
IAQHRGAGARIAEAVREAVCGHRGR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgattccgttgccgaaatgccgtccgaaccgttcggacggcatttgttttgcaggaaat
agaaagatgttccaatggctttatgatgtattgtggctgcttgcgccgatatggatacgg
cgttatttggacaaacgctccggaagtgccccggcatatcgggcgcatcggggcgagcgt
ttcggcaagccgtatccgaatcccgttaccggcgcggtttggatacacgccgtttcggtc
ggggaaacgcgtgccgcccaacctttgatacgcgagttgcggcagcgttttcccgatgcg
ccgctgctgatgacgcagatgaccccgacgggacgggaaaccgcgcaagttctgtttccc
gatgcgcaatgccgctatcttccgtatgacaaaaaaacgtgggtacggcagtttttgcgc
gaacaccgcccgatgttcggcgtattgatggaaacggaaatctggcccaacctaatgaag
gaatgccggcgcgcgggtgtgccgctgtttttggcgaatgcgcggctgtcggaaaaatcg
ttgaacggttatctgaaagtccgcagcctgatccgtcctgctgtcgcttcgctgacgggc
tgtctggtacagacggaggcggatgcggcgcggttggcgaaattgggcgcggcatccgtg
caggtgtgcggcaataccaaatacgacctgatgccgtcggaacagatgaaaacgctggcg
gggcagtttgaaaaacgcatcggagaccggccggttgccgtgtgcggcagcacgcgcgtt
tatcggggtgaagacgaggcggagaaactgctggcggcgtggcaacaatatcgcggcgat
gccctgctggtcgtcgtgccgcgccatcccgagcattttcagacggcatttgaaacggca
aaacgcttcgggtttaaggttcagcggcgcagcgacggtttgccggtcgaacccgatacg
caggtgtggataggcgacagtatgggcgagctgtatgcgtattacctgtgcgccgatgtt
gcttttgtcggcggcagtctggtcgattcgggctgtcagaacatcatcgaaccgctttcc
tgcggcgttccgacgatattcggcttttcgacctacaatttttccgaagcctgccggcac
gccttggcatcgggtgcggcggttcaagtcgaatcggcggacgcgtggcgggaagccgtt
gaaaaaaccttatcgtacgaggggggcggaatgcagatgcaggcgcgcgtggacagcttt
atcgcacaacatcgcggagcgggcgcgagaatcgccgaggcggtgcgggaagcggtatgc
ggacatcgggggcgatag

DBGET integrated database retrieval system