KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0276Help
Entry
NMBG2136_0276     CDS       T01929                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmd01100  Metabolic pathways
nmd01110  Biosynthesis of secondary metabolites
nmd01130  Biosynthesis of antibiotics
nmd01230  Biosynthesis of amino acids
Module
nmd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMBG2136_0276
Enzymes [BR:nmd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NMBG2136_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PIG-X
Motif
Other DBs
NCBI-ProteinID: ADY93016
Position
complement(274969..275751)
Genome map
AA seq 260 aa AA seqDB search
MTDILNKILTAKAQEVAAQKAAVNAEHIRALAAEAAPVRSFIGSIRGKHRLNLPAVIAEI
KKASPSKGLIRPDFRPPEIARAYENAGAACLSVLTDEPYFQGSPEYLKQAREAVSLPVLR
KDFIIDEYQVYQARAWGADAVLLIAAALEQEQLERFEAVAHELGMTVLLELHDETELEKC
RNLTTPLWGVNNRNLRTFEVSLDQTLSLLPALEGKTVVTESGITGKADVEFMQSRGVHTF
LIGETFMRADDIEAEVGKLF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcaataaaatccttaccgccaaggcacaggaagttgccgcccaaaaa
gccgccgtcaacgccgaacacatccgcgcacttgccgcagaagccgcgcccgtccgcagc
tttatcggttcgatacgcggcaaacaccgcctcaacctgcccgccgtcattgccgaaatc
aaaaaggcaagcccgagcaaagggttaatccgtccggacttccgaccgcccgagattgcc
cgcgcctatgaaaacgccggggcggcgtgtttgtccgtactgaccgacgaaccctatttc
caaggttcgcccgaatacctcaaacaggcgcgcgaagccgtatcgctgcccgtgctgcgc
aaagacttcatcatcgacgaatatcaggtttatcaggcgcgcgcatggggggcggatgcc
gtcctgctgattgccgcagcactggaacaggaacaattggaacgctttgaagcggtggcg
cacgaattgggcatgaccgtcctgctcgagctgcacgacgaaaccgaattggaaaaatgc
cgcaacctgaccacgccgttgtggggcgtaaacaaccgcaacctgaggacttttgaagtc
tccctcgaccaaaccctgtcgctgctgcccgcactggaaggcaaaaccgtcgttaccgaa
agcggcattacgggcaaggcggatgtggaatttatgcaatcgcgcggcgtgcacaccttc
ctgattggcgaaacgttcatgcgtgccgacgatattgaggcggaagtgggcaaactcttc
taa

DBGET integrated database retrieval system