KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0333Help
Entry
NMBG2136_0333     CDS       T01929                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMBG2136_0333 (tpiA)
   01230 Biosynthesis of amino acids
    NMBG2136_0333 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBG2136_0333 (tpiA)
   00051 Fructose and mannose metabolism
    NMBG2136_0333 (tpiA)
   00562 Inositol phosphate metabolism
    NMBG2136_0333 (tpiA)
Enzymes [BR:nmd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NMBG2136_0333 (tpiA)
Exosome [BR:nmd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NMBG2136_0333 (tpiA)
  Exosomal proteins of bladder cancer cells
   NMBG2136_0333 (tpiA)
  Exosomal proteins of melanoma cells
   NMBG2136_0333 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(332621..333394)
Genome map
AA seq 257 aa AA seqDB search
MYHQIGMWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccagaacaacaattcgctcatgcaccgcttccgcatcctccccaccgccgaa
cgcgtcctcatcggactcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgtcttaaacaaccgcatcctcacctgcgcccaagacgtgagccgcttccccgac
aacggcgcgtacaccggcgaagtgtccgccgaaatgctcgccgacaccggcacagacatc
gtcctcatcggacactccgaacgcagcctttatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactcatcccgttattgtgcgtcggcgaaagc
ctcgaagagcgcgaagccggcaaagaacacgaagtcatcgcccatcagctttccatcctg
caagggctggataccaaaaacatcgccgtcgcctacgaacccgtctgggcgatcggcacc
ggcaaagtcgccaccgtcgaacagattgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgcgtcctttacggcggaagtgtgaaagcg
gacaacgcggccgacatcttcgcagtaccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcctttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system