KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0333Help
Entry
NMBG2136_0333     CDS       T01929                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00010  Glycolysis / Gluconeogenesis
nmd00051  Fructose and mannose metabolism
nmd00562  Inositol phosphate metabolism
nmd01100  Metabolic pathways
nmd01110  Biosynthesis of secondary metabolites
nmd01120  Microbial metabolism in diverse environments
nmd01130  Biosynthesis of antibiotics
nmd01200  Carbon metabolism
nmd01230  Biosynthesis of amino acids
Module
nmd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBG2136_0333 (tpiA)
   00051 Fructose and mannose metabolism
    NMBG2136_0333 (tpiA)
   00562 Inositol phosphate metabolism
    NMBG2136_0333 (tpiA)
Enzymes [BR:nmd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NMBG2136_0333 (tpiA)
Exosome [BR:nmd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NMBG2136_0333 (tpiA)
  Exosomal proteins of bladder cancer cells
   NMBG2136_0333 (tpiA)
  Exosomal proteins of melanoma cells
   NMBG2136_0333 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADY93071
Position
complement(332621..333394)
Genome map
AA seq 257 aa AA seqDB search
MYHQIGMWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccagaacaacaattcgctcatgcaccgcttccgcatcctccccaccgccgaa
cgcgtcctcatcggactcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgtcttaaacaaccgcatcctcacctgcgcccaagacgtgagccgcttccccgac
aacggcgcgtacaccggcgaagtgtccgccgaaatgctcgccgacaccggcacagacatc
gtcctcatcggacactccgaacgcagcctttatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactcatcccgttattgtgcgtcggcgaaagc
ctcgaagagcgcgaagccggcaaagaacacgaagtcatcgcccatcagctttccatcctg
caagggctggataccaaaaacatcgccgtcgcctacgaacccgtctgggcgatcggcacc
ggcaaagtcgccaccgtcgaacagattgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgcgtcctttacggcggaagtgtgaaagcg
gacaacgcggccgacatcttcgcagtaccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcctttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system