KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0466Help
Entry
NMBG2136_0466     CDS       T01929                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nmd00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:nmd00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(492997..494082)
Genome map
AA seq 361 aa AA seqDB search
MTVPHIPRGPVMADIAAFRLTEEEKQRLLDPAVGGIILFRRNFQNIEQLKTLTAEIKALR
TPELIIAVDHEGGRVQRFIEGFTRLPAMSTLGEIWDKDGASAAETAAGQVGRVLATELSA
CGIDLSFTPVLDLDWGNCPVIGNRSFHHNPEAVAHLALALQKGLAKGGMKSCGKHFPGHG
FVEGDSHLVLPEDRRSLSELEAADLAPFHIMSREGMAAVMPAHVVYPQVDTKPAGFSEIW
LKQILRRDIGFKGVIFSDDLTMEGACGVGGLKERARISFEAGCDIVLVCNRPDLVDELRE
DFRIPDNPALAQRWQYMANTLGSAAAQAVMQTADFQEAQAFVAGLASPQDTAGGVKVGEA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccccatattccgcgcggccccgtcatggcagacattgccgccttccgcctg
accgaagaggaaaagcaacgcctgctcgatcccgccgtaggcggcatcatcctcttccgc
cgcaacttccaaaacatcgaacaactcaaaacactcaccgccgaaatcaaagccctgcgc
acacccgaactcattatcgccgtcgatcacgaaggcggcagggtgcaacgtttcatcgaa
ggcttcacccgcctgcccgcaatgagtacgctcggcgagatttgggacaaagacggcgcg
tccgccgccgaaaccgccgccggacaagtcggccgggttttggcaaccgagctttccgcc
tgcggcatcgatttgtccttcacgcccgtcttagatttggactggggaaactgccccgtc
atcggcaaccgcagtttccaccacaatcccgaagcggtcgcccacctcgccctcgccctt
caaaaaggtttggcaaaaggcggtatgaaatcctgcggcaaacattttcccggacacgga
tttgtcgaaggagacagccatctggtcttgccggaagacaggcgcagcctgtccgaactc
gaagccgccgacctcgcccccttccacattatgagccgcgaaggtatggcggcggttatg
cccgcccacgtcgtttatccacaagtggacacaaagcccgcagggttttccgaaatctgg
ctcaaacaaattttgcgccgcgatatcggattcaaaggcgtgattttctcggacgatttg
actatggagggcgcgtgcggtgtcggcggcctcaaagaacgcgcccgcatttcctttgag
gcaggttgcgacatcgtcctcgtctgcaaccgtcccgaccttgtggacgaactgcgcgaa
gatttccgcattcctgacaatcccgctttggcgcaacgttggcaatatatggccaacacg
ctcggcagtgccgccgcgcaagccgttatgcagacggcggatttccaagaggcgcaagcc
tttgttgccggccttgcctcgccgcaggatacagcgggcggcgtaaaagtcggcgaagcc
ttttaa

DBGET integrated database retrieval system