KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0750Help
Entry
NMBG2136_0750     CDS       T01929                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nmd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
778472..779473
Genome map
AA seq 333 aa AA seqDB search
MQFPYRNVPASRMRRMRRDDFSRRLMREHTLTADDLIYPVFVLEGSAREEDVPSMPGVKR
QSLDRLLFTAEEAVKLGIPMLALFPVVTANKTERAQEAYNPEGLVPSTVRALRERFPELG
IMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAEAGAQVVAPSDMMDGRIG
AIREALEDAGHIHTRIMAYSAKYASAFYGPFRDAVGSSGNLGKADKKTYQMDPANTDEAL
HEVALDIQEGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQVSGEYAMLQAAVANGWLDG
DKVVLESLLAFKRAGADGILTYYAIEAAKMLKR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttccttaccgcaatgttccggcttcgcgtatgcgccgtatgcgcagggacgat
ttttcacgccgcctgatgcgcgaacacacgctgaccgccgatgatttgatttatccggtg
ttcgtattggaggggtcggcgcgcgaggaggatgtgccttctatgccgggtgtgaagcgt
caaagtttggacaggctgctgtttacggcggaagaggcggtaaagctcggtattccgatg
ttggcactgttccccgtggttacggcaaacaaaaccgagcgtgcgcaggaggcgtacaat
cccgaaggactcgtgccgtcaactgtccgcgccttgcgcgagaggtttcccgaactgggc
attatgacggatgtcgcgctcgatccttatacggttcacggtcaggacgggctgacggac
gaaaacggttatgtgatgaacgatgaaaccgtagaggttttggtcaagcaggctttgtgc
cacgctgaagcgggcgcacaggtggttgccccttccgatatgatggacgggcgtatcggt
gcgattcgcgaggcgttggaggatgccgggcatatccacacgcggattatggcgtattcc
gccaaatatgcttcggcgttttacggaccgttccgcgatgcggtgggcagttcgggcaat
ttgggcaaggcggacaagaaaacctaccagatggatccggcaaataccgatgaggcgttg
cacgaagtggcgttggacattcaggaaggtgcggatatggtgatggttaagcccggtttg
ccgtatttggacgttgtccgccgcgtgaaggacgagttcggtgtgccgacttatgcctat
caggtttcgggcgaatatgcgatgctacaggcggcggttgccaacggatggctggatggc
gataaagtggttttggaaagcctgctggcattcaaacgtgcgggtgcggacgggattttg
acctattacgctattgaggcggcaaagatgttgaagcgttga

DBGET integrated database retrieval system