KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0921Help
Entry
NMBG2136_0921     CDS       T01929                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMBG2136_0921 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBG2136_0921 (sdhD)
   00650 Butanoate metabolism
    NMBG2136_0921 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMBG2136_0921 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
933980..934306
Genome map
AA seq 108 aa AA seqDB search
MTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFTQVSFI
AVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSIKVIWG
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggtgcccattacggtttgcgcgattgggcgatgcaacgtgcgactgcggttatt
atgttgatttataccgttgcacttttagtggttctattttccctgcctaaagaatattcg
gcatggcaggcattttttagtcaaacttgggtaaaagtatttacccaagtgagcttcatc
gccgtattcttgcacgcttgggtgggtatccgcgatttgtggatggactatatcaaaccc
ttcggcgtgcgtttgtttttgcaggttgccaccatcgtctggctggtcggctgcttggtg
tattcaattaaagtaatttgggggtaa

DBGET integrated database retrieval system