KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0927Help
Entry
NMBG2136_0927     CDS       T01929                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase succinyl-transferring complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nmd01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nmd00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:nmd00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
941680..943041
Genome map
AA seq 453 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPAAATAAAEAPAAATAAAEAPAAATAAAEAPAAA
TAAAEAPAAATAAAEAPAAATAAAEAPAAAPAEAAPAAAPAAAQNNAAMPAAAKLAAESG
VDVNALQGSGRDGRVLKEDVQNAAAKPAAAAAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgtatcgataccgctgct
actgccgctgctgaagcacctgccgctgctactgccgctgctgaagcacctgccgctgct
actgccgctgctgaagcacctgccgctgctactgccgctgctgaagcacctgccgctgct
actgccgctgctgaagcacctgccgctgctactgccgctgctgaagcacctgccgctgct
actgccgctgctgaagcacctgccgccgctcctgccgaagctgccccggccgccgctcct
gctgctgcacaaaacaacgccgctatgcctgccgccgccaaactggctgcagagagcggt
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgcagccaaacctgccgcagccgctgctcctgccgttgcacttcctgccggc
gcacgtcctgaagaacgcgtaccgatgagccgcctgcgtgcccgtgttgcagaacgcctc
ttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaacca
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaactg
ggctttatgtccttcttcgttaaagccgctgttgcagccctgaaaaaatacccggttgtg
aatgcttctgttgacggcaaagacattgtgtaccacggctacttcgacatcggtatcgcg
attggcagcccacgcggtttggttgtgccaatcctgcgcgatgccgaccaaatgagcatt
gccgacatcgaacaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagatctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtccaccccgatcatcaatccgcctcaatctgcgattttgggtatgcacgccactaaa
gagcgcgctgtggttgaaaacggccaagttgttgtccgtccaatgatgtatctggctctg
tcttacgaccaccgtatcattgacggccgcgaagctgtattgaccttggtagccattaaa
gacgcgttggaagacccagcccgcctgttgttggatctgtaa

DBGET integrated database retrieval system