KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0930Help
Entry
NMBG2136_0930     CDS       T01929                                 

Definition
succinate-CoA ligase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMBG2136_0930
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBG2136_0930
   00640 Propanoate metabolism
    NMBG2136_0930
   00660 C5-Branched dibasic acid metabolism
    NMBG2136_0930
Enzymes [BR:nmd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NMBG2136_0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
945320..946486
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKELLASYGLPVQGGILAHNGEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAKEVAESLIGTNLVTYQTDANGQPVNSVLVCEDMYPVQTELYLGAVVDRSTR
RVTFMASTEGGVEIEKVAAETPEKIFKVTVDPLVGLQPCQAREVAFQLGLKDKQINEFVK
LMTGAYKAFVENDFALFEVNPLAVRENGALACVDGKIGIDSNALYRLPKIAELRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKDRVV
EAFKLILEDKSVKGVLINIFGGIVRCDMIAEAIVAAVKEINVNVPVVVRLEGNNAELGAK
ILNESGLKLTSADGLNDAAEKIVAAVNA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggctaaagaactgctggctagctacggtttgcccgtacaa
ggcggtattttggcacacaacggcgaagaagccgctgcagcttacgacaaattgggcggc
aaattcgctgttgtcaaagcacaagtacacgccggcggccgcggtaaagcgggcggcgta
aaagtcgttaaaagccgcgaagaagctaaagaagtggctgaaagcctgattggcaccaac
ttggtaacttaccaaactgatgccaacggccaacctgtcaacagcgttttggtttgcgaa
gacatgtatcctgttcaaaccgagctgtacttgggcgcagtggttgaccgttctacccgc
cgcgttacattcatggcttctaccgaaggtggcgtagaaatcgaaaaagttgctgccgaa
actccagaaaaaatcttcaaagtaaccgttgatccgctggtcggcctgcaaccttgccaa
gctcgcgaagttgccttccaactgggcttgaaagacaaacaaatcaacgagttcgtcaaa
ctgatgaccggcgcgtacaaagcgtttgtcgaaaacgacttcgccctgtttgaagtcaac
ccgctggcagttcgcgaaaacggcgcactggcttgcgtggacggcaaaatcggcatcgac
agcaacgcgctctaccgcctgccaaaaatcgctgaattgcgcgacaaatctcaagaaaac
gaacgtgaactgaaagcttctgaattcgacctgaactatgttgccctggaaggcaacatc
ggctgtatggtgaacggcgcaggtttggcgatggctactatggacatcatcaaactgaaa
ggcggccaacctgccaacttcttggacgttggtggcggcgcaaccaaagaccgcgtggtt
gaagcgttcaaactgattttggaagacaaatccgttaaaggagtattgatcaacatcttc
ggcggtatcgtacgttgcgacatgattgcggaagccatcgtggcagccgttaaagaaatc
aacgtcaacgttcctgtcgttgttcgtttggaaggtaacaacgccgaactcggcgcgaaa
atcctgaacgaatcaggtctgaaactgacttccgccgacggcctgaatgacgcagccgaa
aaaattgttgcagccgtaaacgcctaa

DBGET integrated database retrieval system