KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_1502Help
Entry
NMBG2136_1502     CDS       T01929                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NMBG2136_1502
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMBG2136_1502
Enzymes [BR:nmd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NMBG2136_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1585456..1586055)
Genome map
AA seq 199 aa AA seqDB search
MLLSCRLKHVSDGIGLHQIRIKMGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLT
PQYEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVN
GANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVE
RFAPSVTPEEIEADIRALL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgctgctttcatgccgtctgaagcacgtttcagatggcatcggtttacatcagataagg
ataaaaatgggtatttacgattttcaaatgaaagatgcggaaggcaatgcggttgatttg
tcaggctatcgcggcaaggttctgctgattgtcaacacggcaacgcgttgcggtctgacc
ccgcaatacgaggctttgcagaagctgtatgcacaatataccgcagaaggcttggagatt
ttggattttccgtgcaaccagttccgcgaacaggctcccgaaagcagcggagaaattgcc
caagtgtgtatgatgaagtttggcacgaagtttaagattttcgacaaaatcgaagtcaat
ggagcaaataccgcgcccttgtatgcctacctgaaatccgtcaaaccgcaagataaaggc
aatcatctgtttaaagatttcgtgttgaagctcgcagctttgggagagaagcgcgacgaa
ggcgacatcaaatggaactttaccaaattcctcgtcaaccgcgacggcgaagtggtcgag
cgttttgcgcctagtgttacgcccgaagaaatcgaagccgatattcgggcattgctgtaa

DBGET integrated database retrieval system