KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_1688Help
Entry
NMBG2136_1688     CDS       T01929                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nmd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nmd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1801421..1802899)
Genome map
AA seq 492 aa AA seqDB search
MFSKLTPLAETGIPTLSCANAAGRLLHSDSRQIKQGDIFVACPGEYADGRSYIPAAVANG
AAFVFWDDDGKFAWNPEWKVPNQGIKDLKHRAGILAAQVYGNVSDGLKVWGVTGTNGKTS
ITQWLAQAADLLGEKTAIVGTVGNGFWGALEETTHTTPAPVDVQTLLYRFRQQGATVAAM
EISSHGLDQSRVNGVSFRSAIFTNLTRDHLDYHGTMEAYGAIKSRLFYWHGLKHAVINVD
DEYGAELAGRLKKDCPDLAVYSYGFSEHADIRITDFTASSDGIAAVFQTPWGEGKCRTRL
LGRFNAQNLAACIALLCANGYPLDKVLDVLAKIRPASGRMDCIMNSGKPLVVVDYAHTPD
ALEKALATLQEIKPQGAALWCVFGCGGNRDRGKRLLMGAAAVQGADKVVVTSDNPRLENP
HDIINDILPAVPAPECVEADRAAAIRYAVEQAAANDIILIAGKGHENYQDVQGVKHRFSD
LEIVGQALLTRK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcaagttaacccctttggctgaaaccggcatcccgaccctgtcgtgtgcaaac
gcggcagggcgtttgttgcattcagacagccgccaaatcaaacaaggcgatattttcgtt
gcctgtccgggcgaatatgccgacggacgcagttatatccccgccgccgttgccaacggc
gcggcttttgttttttgggacgacgatggcaaattcgcgtggaatcccgaatggaaagtc
cccaatcaaggcatcaaagatttgaaacaccgtgccggcatattggcggcgcaagtttac
ggcaacgtttcagacggtctcaaagtctggggcgtaaccggaaccaacggcaaaacctcc
atcacgcaatggctggcgcaagctgccgatttgttgggcgaaaaaaccgccattgtcggc
acggtcggcaacggcttttggggtgcattggaagaaaccacgcataccacacccgccccc
gtcgatgtccaaaccctgctctaccgtttccgtcaacaaggcgcaacagtcgccgcgatg
gaaatctccagccacgggcttgaccagtcgcgcgtcaacggcgtgtcattccgcagcgca
atctttaccaacctcacccgcgaccacctcgactaccacggcacgatggaagcctacggt
gccatcaagtcgcgcctgttttactggcacggcttgaaacacgcagtcatcaacgtggat
gacgaatacggcgcggaactcgcaggtcgtctgaaaaaagattgtcccgatttggccgtt
tatagctacggcttcagcgaacacgccgacatccgcattaccgactttaccgcctcttca
gacggcatagcagccgtattccaaaccccgtggggcgaagggaaatgccgcacgcgcctg
ctcggacggttcaacgcgcaaaacctcgccgcctgcatcgccttgctgtgcgccaacggc
tatccgcttgataaagtattggatgtgctggcaaaaatccgtcccgcttcagggcgcatg
gactgcatcatgaacagcggcaaacctttggtcgttgtcgattatgcccacacgcccgac
gcattggaaaaagcactcgccaccttgcaggaaatcaaaccgcagggtgcggctttgtgg
tgcgtattcggttgcggcggtaaccgcgatcgcggcaaacgcctgctgatgggcgcggca
gccgtacagggtgcggataaagtcgtcgtcaccagcgacaacccgcgtttggaaaatccg
cacgacatcatcaacgacatcctgcctgccgttcccgcgcccgaatgcgtcgaagccgac
cgtgccgccgccatccgttatgcggttgaacaagccgccgcaaacgacatcatcctgatt
gccggcaaagggcatgaaaactatcaggatgtacaaggcgtgaagcaccgtttttccgat
cttgaaatcgtcggacaggctttgttaactcgtaaataa

DBGET integrated database retrieval system