KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_1714Help
Entry
NMBG2136_1714     CDS       T01929                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBG2136_1714
   00052 Galactose metabolism
    NMBG2136_1714
Enzymes [BR:nmd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     NMBG2136_1714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1833428..1834465)
Genome map
AA seq 345 aa AA seqDB search
MSDTPATPATPATPATRDFGLIDGRAVTGYVLSNRRGTRVCVLDLGGIVQEFSVLADGVR
ENLVVSFDDAASYADNPFQINKQIGRVAGRIRGAAFDINGRTYRVEANEGRNALHGGSHG
LAVTRFNAVAADGRSVVLRSRLQQSADGYPNDLDLDISYRLDEDNRLTVSYRATALGDTV
FDPTLHIYWRLDAGLHDAVLHIPQGGHIPADAEKLPVSTVSDDLEVFDFSRPKPLDAAVA
ALRRETGRAGFDDAYRVPSDIGRPAAVLQAGRRRRISIYSDRNGLVIFTAAPQDFARHDA
GVYDALATEAQTLPDSLNWPEFGNIRLNKGDTREATIAYGIESLS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacccccgctacccccgctacccccgctacccccgctacccgcgatttcggc
ctgatcgacgggcgtgccgtaaccggctatgtgctgtccaatcggcgtggtacgcgtgtc
tgcgtgctggacttgggcgggattgtgcaggaattttccgttttggcagacggcgtgcgc
gaaaacctcgtggtgtcgttcgacgatgcggcttcctatgcggacaatccgtttcagatt
aacaagcagatagggcgcgtggccggacgcatccgcggtgcggcgttcgacatcaacggc
aggacttaccgcgtggaggccaacgaaggcaggaacgcgctgcacggcggttcgcacggg
ctggccgttacccgtttcaacgcggtggcggcagacggccgttcggtggtgctgcgcagc
cgcctgcaacagtcggccgacggttatcccaacgatttggatttggatatttcctaccgc
ttggacgaggacaaccggcttaccgttagctatcgcgccaccgcgctcggcgacacggtg
ttcgacccgacgctgcacatttactggcggctggacgcgggcctgcacgatgcggttctg
catattccgcagggcggacatattccggccgatgccgaaaaactgcccgtctcaacggtt
tcagacgacctcgaagtatttgatttcagccggcccaagccgctggatgccgccgttgcc
gccctgcgccgcgaaacgggtcgggccggttttgacgacgcttaccgcgtgccgtccgat
ataggccgtcccgccgctgtgttgcaagccggacgccgccgtcgtatcagcatatacagc
gaccgcaacggcttggtcatctttaccgccgccccgcaggatttcgcgcggcacgatgcg
ggcgtttacgacgcgctggcgaccgaggcgcagacgctgcccgacagcctgaattggccc
gagttcggcaatattcgtctgaacaagggtgataccagggaggcgacgattgcttacggc
atcgaatccctttcttag

DBGET integrated database retrieval system