KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0003Help
Entry
NMB0003           CDS       T00027                                 

Gene name
gltX
Definition
(RefSeq) glutamyl-tRNA synthetase
  KO
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMB0003 (gltX)
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMB0003 (gltX)
Enzymes [BR:nme01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     NMB0003 (gltX)
Amino acid related enzymes [BR:nme01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   NMB0003 (gltX)
Transfer RNA biogenesis [BR:nme03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NMB0003 (gltX)
 Prokaryotic Type
   Other AARSs
    NMB0003 (gltX)
Prokaryotic defense system [BR:nme02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    NMB0003 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(918..2312)
Genome map
AA seq 464 aa AA seqDB search
MTVKTRFAPSPTGYLHIGGVRTALFSWAFARHHKGEFLLRIEDTDLARSTAESVNIILDG
MKWVGLNYDNADNVVYQTRRFDRYKEVIAELLEKGHAYYCYCSKEELEAMREKAEKEGSA
TYDRRWRPEVGKTLPEIPSDVQPVVRFKTPLDGVTKWTDLVKGEISIPNEALDDLIIARA
DGTPTYNFCVVVDDYDMGVTHVIRGDDHVNNTPKQINILKAIDANLPEYGHLPMILNEQG
KKISKRSGDTVAITDFGAMGILPEAMLNYLARLGWAHGDDEFFTMEQFIEWFDLKDVSPS
PSRMDLKKLYWINGEHIKITPNGKLAELVKPRLALRDIHETEKPALEDVLELVKDRPQDL
NTLADECFYFYVKQTPAEADVQKHWDDEAAARMLRFAERLEGLEDWNAEAIHDLFKPFCD
EEGIKMGKLGMPLRLAVCGTAKTPSVDAVLALIGKEEVLKRIRA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaaaacccgtttcgcccccagccccaccggctacctgcacatcggcggcgtg
cgcaccgccttgttttcatgggcgtttgcccgccatcataaaggcgagttcctattacgt
attgaagacaccgacttggcgcgttctaccgccgaatccgtcaacatcatcctcgacggc
atgaaatgggtcggtctcaattacgacaacgccgacaacgtcgtttaccaaactcgccgt
ttcgaccgctacaaagaggtcattgccgaacttttagaaaaaggccatgcctactactgc
tattgcagcaaagaagagctggaagccatgcgtgagaaagccgaaaaagaaggctcggcg
acttacgaccgccgctggcgtccggaagtaggtaaaaccctgcccgaaatcccgtccgac
gtacaacccgttgtccgtttcaaaacgcctttggacggtgtgaccaaatggacagacttg
gtcaaaggcgaaatctccatccccaacgaagcactcgatgacctgattatcgcccgcgcc
gacggtacgccgacctacaacttctgcgttgtcgtagacgactacgacatgggcgttacc
cacgttatccgcggcgacgaccatgtgaacaacacgccgaaacaaatcaacatcttaaaa
gccatcgacgcgaacctgcccgaatacggccacctgccgatgattcttaacgaacaaggc
aaaaaaatctccaaacgcagcggcgataccgttgccattaccgatttcggcgcaatgggc
atcctgcccgaagcgatgctcaactatctggcacgcttgggctgggcgcacggcgacgat
gaattcttcacaatggaacaattcatcgaatggtttgatttgaaagacgtttccccgtct
ccaagccgtatggacttgaaaaaactctactggatcaacggcgaacacatcaaaatcaca
cccaacggcaaactcgccgaactcgtcaaaccccgccttgcgttgcgcgatattcatgaa
accgaaaaacctgctttggaagatgtgttggaactggtcaaagaccgcccccaagacttg
aacacgcttgccgacgagtgcttctacttctacgtcaaacaaacgcctgccgaagcagac
gtgcagaaacactgggacgatgaagccgccgcccgtatgctgcgctttgccgaacgcctc
gaagggctggaagactggaatgccgaagccatccacgacctcttcaaacccttctgcgac
gaagaaggcattaaaatgggcaaactcggcatgcccctgcgccttgccgtctgcggtacg
gcgaaaacccccagcgtcgatgctgtgttggcattaatcggcaaagaagaagtgttgaaa
cgcatccgcgcttaa

DBGET integrated database retrieval system