KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0006Help
Entry
NMB0006           CDS       T00027                                 

Definition
(RefSeq) thioredoxin-like protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3635..4117
Genome map
AA seq 160 aa AA seqDB search
MKYLNLAAITLAATFAAHTASADELAGWKDNTPQSLQSLKAPVRIVNLWATWCGPCRKEM
PAMSKWYKAQKKGSVDMVGIALDTSDNIGNFLKQTPVSYPIWRYTGANSRNFMKTYGNTV
GVLPFTVVEAPKCGYRQTITGEVNEKSLTDAVKLAHSKCR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacttgaatcttgccgcaatcacccttgccgccacatttgccgcacataccgcc
tcggcagacgaactggccggatggaaagacaacaccccgcaaagcctgcaatcgctcaaa
gcccccgtacgcatcgtcaacctttgggcgacttggtgcggcccgtgccgaaaagagatg
cctgccatgtccaaatggtacaaagcgcagaaaaaaggcagcgtcgatatggtcggcatc
gcgctcgacacatccgacaatatcggcaacttcctcaaacaaactcctgtttcctacccg
atttggcgttacaccggggcgaacagccgaaactttatgaaaacctacggaaacactgtc
ggcgtactgccctttaccgtcgtcgaagcaccgaaatgcggatacaggcagaccattacc
ggggaggtaaacgaaaaaagcctgaccgacgccgtcaaactcgcccattcaaaatgccgt
taa

DBGET integrated database retrieval system