KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0010Help
Entry
NMB0010           CDS       T00027                                 

Gene name
pgk
Definition
(RefSeq) phosphoglycerate kinase
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0010 (pgk)
   01230 Biosynthesis of amino acids
    NMB0010 (pgk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0010 (pgk)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     NMB0010 (pgk)
Exosome [BR:nme04147]
 Exosomal proteins
  Proteins found in most exosomes
   NMB0010 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(6281..7492)
Genome map
AA seq 403 aa AA seqDB search
MAFLKLTEQNVQGKTVLIRADMNVPFKDGKISDDTRIRASLASIKYCVDNGASVIVMTHL
GRPTEGEFHPEDDVAPVAAHLGSLLGKDVKVLNDWRENKPALNAGDVVMLQNVRINKGEK
KNDLELGKAYASLCDVFVNDAFGTAHRAQASTEAVAQAAPVACAGVLMAGELDALGKALK
QPARPMVAIVAGSKVSTKLTILESLADKVDQLIVGGGIANTFLLAEGKAIGKSLAEHDLV
EESKKIMAKMAAKGGSVPLPTDVVVAKAFAADAEAVVKDIAADAEAVVKDIADVAEDEMI
LDIGPKSAAALADLLKAAGTVVWNGPVGVFEFDQFAGGTKALAEAIAQSKAFSIAGGGDT
LAAIAKFGVTEQIGYISTGGGAFLEFLEGKELPAVAALEKRGA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcatttttaaaactgaccgaacaaaacgtgcagggcaaaaccgtcctcatccgcgcc
gatatgaacgtaccgttcaaagacggcaaaatcagcgacgacacccgtatccgcgcctcg
ctcgcgtccattaaatactgcgtggacaacggtgcgtccgttatcgtgatgacccatctc
ggccgcccgaccgaaggcgagttccaccccgaagacgatgtcgcccccgttgccgcgcac
ttgggcagcctgttgggcaaagacgtgaaagtattgaacgactggcgtgaaaacaaaccc
gccctgaacgcgggcgatgtcgtcatgctgcaaaacgtgcgcatcaacaaaggcgagaag
aaaaacgatttggaactgggtaaagcctacgcttctttgtgcgacgtgttcgtcaatgac
gcgttcggaaccgcccaccgcgcccaagcctcgaccgaagccgtcgcccaagccgcgccc
gttgcctgcgccggcgtattgatggcgggcgaactcgacgctttgggcaaagccttgaaa
cagcccgcgcgcccgatggttgccatcgttgccggcagcaaagtgtccaccaagctgacc
atcctcgaatcgctggcggacaaagtcgaccaactcatcgtcggcggcggtatcgcaaac
accttcctgttggcggaaggcaaagccatcggcaaatctttggcggaacacgatttggtg
gaagaatccaaaaaaattatggcgaaaatggcggcaaaaggcggttctgtgccgctgccg
accgatgtcgtcgttgccaaagcctttgccgccgatgcggaagctgtggtgaaagacatt
gccgccgatgcggaagctgtggtgaaagacattgccgacgttgccgaagacgagatgatt
ttggacatcggtccgaaatccgctgccgcgcttgccgatttgcttaaagccgccggtacg
gtcgtttggaacgggccggtcggcgtgttcgagtttgaccaattcgcaggcggtacgaaa
gcccttgccgaagccattgcccaaagcaaagcgttctcgattgcgggcggcggcgacacg
ctggcggcgattgccaaattcggcgttaccgaacaaatcggctacatctccaccggcggc
ggcgcgttccttgagttcttggaaggcaaagagctgcctgccgtagccgctttggaaaaa
cgcggcgcgtaa

DBGET integrated database retrieval system